(data stored in SCRATCH zone)

EMBL: AL009126.DUSB

AL009126.DUSB        Location/Qualifiers
FT   CDS             87634..88635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusB"
FT                   /locus_tag="BSU_00810"
FT                   /old_locus_tag="BSU00810"
FT                   /product="tRNA-dihydrouridine synthase B"
FT                   /function="16.6: Maintain"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.3: Control"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 11983710, 15698474, 26112661;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00810"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11857"
FT                   /db_xref="GOA:P37567"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="SubtiList:BG10143"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37567"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11857.1"
FT                   /translation="MFKIGDIQLKNRVVLAPMAGVCNSAFRLTVKEFGAGLVCAEMVSD
FT                   KAILYNNARTMGMLYIDEREKPLSLQIFGGKKETLVEAAKFVDQNTTADIIDINMGCPV
FT                   PKITKCDAGAKWLLDPDKIYEMVSAVVDAVNKPVTVKMRMGWDEDHIFAVKNAQAVERA
FT                   GGKAVALHGRTRVQMYEGTANWDIIKEVKQSVSIPVIGNGDVKTPQDAKRMLDETGVDG
FT                   VMIGRAALGNPWMIYRTVQYLETGKLKEEPQVREKMAVCKLHLDRLIDLKGENVAVREM
FT                   RKHAAWYLKGVKGNANVRNEINHCETREEFVQLLDAFTVEVEAKELQNAKVG"
     MFKIGDIQLK NRVVLAPMAG VCNSAFRLTV KEFGAGLVCA EMVSDKAILY NNARTMGMLY        60
     IDEREKPLSL QIFGGKKETL VEAAKFVDQN TTADIIDINM GCPVPKITKC DAGAKWLLDP       120
     DKIYEMVSAV VDAVNKPVTV KMRMGWDEDH IFAVKNAQAV ERAGGKAVAL HGRTRVQMYE       180
     GTANWDIIKE VKQSVSIPVI GNGDVKTPQD AKRMLDETGV DGVMIGRAAL GNPWMIYRTV       240
     QYLETGKLKE EPQVREKMAV CKLHLDRLID LKGENVAVRE MRKHAAWYLK GVKGNANVRN       300
     EINHCETREE FVQLLDAFTV EVEAKELQNA KVG                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page