(data stored in ACNUC7421 zone)

EMBL: AL009126.EBFC

AL009126.EBFC        Location/Qualifiers
FT   CDS             28529..28852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ebfC"
FT                   /locus_tag="BSU_00200"
FT                   /old_locus_tag="BSU00200"
FT                   /product="nucleoid associated protein"
FT                   /function="16.3: Control"
FT                   /function="16.9: Replicate"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 16740939, 19208644, 19594923,
FT                   20639362, 22333191, 22544270; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00200"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11796"
FT                   /db_xref="GOA:P24281"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="SubtiList:BG10084"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24281"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11796.1"
FT                   /translation="MRGGMGNMQKMMKQMQKMQKDMAKAQEELAEKVVEGTAGGGMVTV
FT                   KANGQKEILDVIIKEEVVDPEDIDMLQDLVLAATNEALKKVDEITNETMGQFTKGMNMP
FT                   GLF"
     MRGGMGNMQK MMKQMQKMQK DMAKAQEELA EKVVEGTAGG GMVTVKANGQ KEILDVIIKE        60
     EVVDPEDIDM LQDLVLAATN EALKKVDEIT NETMGQFTKG MNMPGLF                     107
//

If you have problems or comments...

PBIL Back to PBIL home page