(data stored in SCRATCH zone)

EMBL: AL009126.ECFA

AL009126.ECFA        Location/Qualifiers
FT   CDS             150443..151288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecfA"
FT                   /locus_tag="BSU_01450"
FT                   /old_locus_tag="BSU01450"
FT                   /product="energizing coupling factor of ABC influx
FT                   transporter (ATP-binding protein)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12110480, 21135102, 26052893;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01450"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11921"
FT                   /db_xref="GOA:P40735"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="SubtiList:BG11067"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40735"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11921.2"
FT                   /translation="MNQNQLISVEDIVFRYRKDAERRALDGVSLQVYEGEWLAIVGHNG
FT                   SGKSTLARALNGLILPESGDIEVAGIQLTEESVWEVRKKIGMVFQNPDNQFVGTTVRDD
FT                   VAFGLENNGVPREEMIERVDWAVKQVNMQDFLDQEPHHLSGGQKQRVAIAGVIAARPDI
FT                   IILDEATSMLDPIGREEVLETVRHLKEQGMATVISITHDLNEAAKADRIIVMNGGKKYA
FT                   EGPPEEIFKLNKELVRIGLDLPFSFQLSQLLRENGLALEENHLTQEGLVKELWTLQSKM
FT                   "
     MNQNQLISVE DIVFRYRKDA ERRALDGVSL QVYEGEWLAI VGHNGSGKST LARALNGLIL        60
     PESGDIEVAG IQLTEESVWE VRKKIGMVFQ NPDNQFVGTT VRDDVAFGLE NNGVPREEMI       120
     ERVDWAVKQV NMQDFLDQEP HHLSGGQKQR VAIAGVIAAR PDIIILDEAT SMLDPIGREE       180
     VLETVRHLKE QGMATVISIT HDLNEAAKAD RIIVMNGGKK YAEGPPEEIF KLNKELVRIG       240
     LDLPFSFQLS QLLRENGLAL EENHLTQEGL VKELWTLQSK M                           281
//

If you have problems or comments...

PBIL Back to PBIL home page