(data stored in ACNUC7421 zone)

EMBL: AL009126.ECFAB

AL009126.ECFAB       Location/Qualifiers
FT   CDS             151303..152133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecfAB"
FT                   /locus_tag="BSU_01460"
FT                   /old_locus_tag="BSU01460"
FT                   /product="energizing coupling factor of ABC influx
FT                   transporter (ATP-binding protein)"
FT                   /function="16.1: Circulate"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12110480, 21135102, 26052893;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01460"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11922"
FT                   /db_xref="GOA:P70970"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="SubtiList:BG11989"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70970"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12110480, 21135102, 26052893"
FT                   /protein_id="CAB11922.1"
FT                   /translation="MKTPFERLALYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLK
FT                   PTKGQISLGSTVIQAGKKNKDLKKLRKKVGIVFQFPEHQLFEETVLKDISFGPMNFGVK
FT                   KEDAEQKAREMLQLVGLSEELLDRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGL
FT                   DPRGRKEIMDMFYELHQRGNLTTILVTHSMEDAAAYADEMIVMHKGTIQASGSPRDLFL
FT                   KGEEMAGWGLDLPETIKFQRHLEAALGVRFNEPMLTIEDAAAEIRALFQGEKTL"
     MKTPFERLAL YDINASIKEG SYVAVIGHTG SGKSTLLQHL NGLLKPTKGQ ISLGSTVIQA        60
     GKKNKDLKKL RKKVGIVFQF PEHQLFEETV LKDISFGPMN FGVKKEDAEQ KAREMLQLVG       120
     LSEELLDRSP FELSGGQMRR VAIAGVLAMD PEVLVLDEPT AGLDPRGRKE IMDMFYELHQ       180
     RGNLTTILVT HSMEDAAAYA DEMIVMHKGT IQASGSPRDL FLKGEEMAGW GLDLPETIKF       240
     QRHLEAALGV RFNEPMLTIE DAAAEIRALF QGEKTL                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page