(data stored in ACNUC7421 zone)

EMBL: AL009126.EESA

AL009126.EESA        Location/Qualifiers
FT   CDS             complement(179595..180347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eesA"
FT                   /locus_tag="BSU_01600"
FT                   /old_locus_tag="BSU01600"
FT                   /product="iron-chelator (enterobactin family) esterase"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12354229, 2974033, 17725565,
FT                   22210890, 28283524; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01600"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11936"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="SubtiList:BG11565"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55192"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12354229, 2974033, 17725565, 22210890, 28283524"
FT                   /protein_id="CAB11936.2"
FT                   /translation="MKGSLSEHKAGNRRFTLYLPPSYSTDSGGFPAVYVQDGSSLFQNQ
FT                   IELLESAFQQQRLPELVLIGIEPENRLDEYTPWPAASLSDRFTDFGGMGYHYLSDITNQ
FT                   FIPLIEENWNVTREPQSRGMIGASLGGLISMFAILKYPSMFGKIGSISGSYWYENAAET
FT                   IHISSLKPGTARVFMSIGSEEGREKQSIQRHMLKKTKQVHQSLKEKGFTEDQLCLSIEK
FT                   GAVHHHKYFCKQFINALEWLYGKNRSTL"
     MKGSLSEHKA GNRRFTLYLP PSYSTDSGGF PAVYVQDGSS LFQNQIELLE SAFQQQRLPE        60
     LVLIGIEPEN RLDEYTPWPA ASLSDRFTDF GGMGYHYLSD ITNQFIPLIE ENWNVTREPQ       120
     SRGMIGASLG GLISMFAILK YPSMFGKIGS ISGSYWYENA AETIHISSLK PGTARVFMSI       180
     GSEEGREKQS IQRHMLKKTK QVHQSLKEKG FTEDQLCLSI EKGAVHHHKY FCKQFINALE       240
     WLYGKNRSTL                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page