(data stored in ACNUC7421 zone)

EMBL: AL009126.EPSK

AL009126.EPSK        Location/Qualifiers
FT   CDS             480013..480864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epsK"
FT                   /locus_tag="BSU_04280"
FT                   /old_locus_tag="BSU04280"
FT                   /product="cyclic-di-GMP receptor"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 23893111, 27897378; Product
FT                   type rc: receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04280"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12235"
FT                   /db_xref="GOA:P96585"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="SubtiList:BG12058"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96585"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:23893111, 27897378"
FT                   /protein_id="CAB12235.1"
FT                   /translation="MKISFSESQKLFAYFSGLIAALSLFIYYVSAQQSEGALILCITFG
FT                   VIAAGIWFGPIYALAVTLIVLFVLGTLMMFFQTGQTSLFPAEEGLRMLVVWGIALLLFS
FT                   FISGRIHDITAELRRSMTRLQSEIKSYVAVDRVTGFDNKQRMKLELSEEIKRAERYGNS
FT                   FVFLLLHMHYFKEFKSLYGEKETDRLFQYVGQQIRTSVRETDKKFRPSDERIGIVLTHT
FT                   PAEHMPAVLTKLKKQLDTYQLENGKYVSLTFHVCYLPYRNDIQTADQFLEELENEMMMN
FT                   EL"
     MKISFSESQK LFAYFSGLIA ALSLFIYYVS AQQSEGALIL CITFGVIAAG IWFGPIYALA        60
     VTLIVLFVLG TLMMFFQTGQ TSLFPAEEGL RMLVVWGIAL LLFSFISGRI HDITAELRRS       120
     MTRLQSEIKS YVAVDRVTGF DNKQRMKLEL SEEIKRAERY GNSFVFLLLH MHYFKEFKSL       180
     YGEKETDRLF QYVGQQIRTS VRETDKKFRP SDERIGIVLT HTPAEHMPAV LTKLKKQLDT       240
     YQLENGKYVS LTFHVCYLPY RNDIQTADQF LEELENEMMM NEL                         283
//

If you have problems or comments...

PBIL Back to PBIL home page