(data stored in ACNUC7421 zone)

EMBL: AL009126.FEUC

AL009126.FEUC        Location/Qualifiers
FT   CDS             complement(180344..181354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feuC"
FT                   /locus_tag="BSU_01610"
FT                   /old_locus_tag="BSU01610"
FT                   /product="iron-uptake protein"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1c: Function from experimental evidences in
FT                   the studied genus; PubMedId: 2651410, 15849754, 16850406,
FT                   27375568; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01610"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11937"
FT                   /db_xref="GOA:P40411"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="SubtiList:BG10837"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40411"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11937.2"
FT                   /translation="MAKKYALFIALILVVSYFSLTSGSFSVRPAELLSTLFQIDPNPQY
FT                   EILLFDLRLPRVVMAAIIGLGLGIAGAVIQAITRNGLADPGILGINAGAGAGIVAFMLL
FT                   FQGQKEVTSIAAAMGMPLFGLIGGLIAAILIYIFAWHRGNLDSGRIILVGIAINSGFSA
FT                   LSLFLSLKMDPQDYQMAMVWKNGSIWSANWTYITAVLPWMLLFIPILIGKSRLLDTIRF
FT                   DEDTVRSLGISSNKEKTILLVACVAIISACVSVAGSMAFVGLIAPHISRRLAGVEHRYI
FT                   LPLSGLIGMLLVISADFAGKLFFQPAEVPAGIILAILGVPYFLYLLFKQKKGENA"
     MAKKYALFIA LILVVSYFSL TSGSFSVRPA ELLSTLFQID PNPQYEILLF DLRLPRVVMA        60
     AIIGLGLGIA GAVIQAITRN GLADPGILGI NAGAGAGIVA FMLLFQGQKE VTSIAAAMGM       120
     PLFGLIGGLI AAILIYIFAW HRGNLDSGRI ILVGIAINSG FSALSLFLSL KMDPQDYQMA       180
     MVWKNGSIWS ANWTYITAVL PWMLLFIPIL IGKSRLLDTI RFDEDTVRSL GISSNKEKTI       240
     LLVACVAIIS ACVSVAGSMA FVGLIAPHIS RRLAGVEHRY ILPLSGLIGM LLVISADFAG       300
     KLFFQPAEVP AGIILAILGV PYFLYLLFKQ KKGENA                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page