(data stored in SCRATCH zone)

EMBL: AL009126.FFOR

AL009126.FFOR        Location/Qualifiers
FT   CDS             352858..353868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffoR"
FT                   /locus_tag="BSU_03270"
FT                   /old_locus_tag="BSU03270"
FT                   /product="Fur-regulated NADPH:ferredoxin oxidoreductase"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /EC_number="1.8.1.-"
FT                   /EC_number="1.18.1.-"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16672620, 25826316; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03270"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12121"
FT                   /db_xref="GOA:O31475"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PDB:5XHU"
FT                   /db_xref="SubtiList:BG12018"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31475"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16672620, 25826316"
FT                   /protein_id="CAB12121.1"
FT                   /translation="MAENQEVYDVTIIGGGPIGLFTAFYCGMRELKTKVIEFLPKLGGK
FT                   VSLFFPEKIIRDIGGIPGIAGKQLIEQLKEQAATFDPDIVLNQRVTGFERLDDGTIVLT
FT                   GSEGKKHYTRTVILACGMGTLEVNEFDSEDAARYAGKNLHYGVEKLDAFKGKRVVISGG
FT                   GDTAVDWANELEPIAASVTVVHRREEFGGMESSVTKMKQSSVRVLTPYRLEQLNGDEEG
FT                   IKSVTVCHTESGQRKDIEIDELIINHGFKIDLGPMMEWGLEIEEGRVKADRHMRTNLPG
FT                   VFVAGDAAFYESKLRLIAGGFTEGPTAVNSAKAYLDPKAENMAMYSTHHKKLVHK"
     MAENQEVYDV TIIGGGPIGL FTAFYCGMRE LKTKVIEFLP KLGGKVSLFF PEKIIRDIGG        60
     IPGIAGKQLI EQLKEQAATF DPDIVLNQRV TGFERLDDGT IVLTGSEGKK HYTRTVILAC       120
     GMGTLEVNEF DSEDAARYAG KNLHYGVEKL DAFKGKRVVI SGGGDTAVDW ANELEPIAAS       180
     VTVVHRREEF GGMESSVTKM KQSSVRVLTP YRLEQLNGDE EGIKSVTVCH TESGQRKDIE       240
     IDELIINHGF KIDLGPMMEW GLEIEEGRVK ADRHMRTNLP GVFVAGDAAF YESKLRLIAG       300
     GFTEGPTAVN SAKAYLDPKA ENMAMYSTHH KKLVHK                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page