(data stored in SCRATCH zone)

EMBL: AL009126.FOLB

AL009126.FOLB        Location/Qualifiers
FT   CDS             86587..86949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="BSU_00780"
FT                   /old_locus_tag="BSU00780"
FT                   /product="dihydroneopterin aldolase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="4.1.2.25"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 16188473, 17176045, 17388809;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00780"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11854"
FT                   /db_xref="GOA:P28823"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="SubtiList:BG10141"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28823"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11854.1"
FT                   /translation="MDKVYVEGMEFYGYHGVFTEENKLGQRFKVDLTAELDLSKAGQTD
FT                   DLEQTINYAELYHVCKDIVEGEPVKLVETLAERIAGTVLGKFQPVQQCTVKVIKPDPPI
FT                   PGHYKSVAIEITRKKS"
     MDKVYVEGME FYGYHGVFTE ENKLGQRFKV DLTAELDLSK AGQTDDLEQT INYAELYHVC        60
     KDIVEGEPVK LVETLAERIA GTVLGKFQPV QQCTVKVIKP DPPIPGHYKS VAIEITRKKS       120
//

If you have problems or comments...

PBIL Back to PBIL home page