(data stored in SCRATCH zone)

EMBL: AL009126.FOLEB

AL009126.FOLEB       Location/Qualifiers
FT   CDS             364259..365173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folEB"
FT                   /locus_tag="BSU_03340"
FT                   /old_locus_tag="BSU03340"
FT                   /product="GTP cyclohydrolase I"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="3.5.4.16"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12426338, 17032654, 19767425;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03340"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12128"
FT                   /db_xref="GOA:P94398"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="SubtiList:BG12019"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94398"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12426338, 17032654, 19767425"
FT                   /protein_id="CAB12128.2"
FT                   /translation="MNQHTLLPKKTERLQYFGSVSPIKGEKPVEKEKMKDLQNIRKDYF
FT                   FDIQHVGVANVSHPVTITSAMMPAEQTTAANFTMTCNLPRNQKGINMSRLTELLQVYHQ
FT                   NGWILSFSSLQQFTKELAENMDTSSATVEVRFPWFFERKSPKLEKAGLMHADIFMSVTY
FT                   RKDQPFKQRAGISAKVTTLCPCSKEISEYSAHNQRGTVSIWADIHPAASLPSDVKADLL
FT                   HAAESNASARLHPVLKRPDEKAVTETAYENPRFVEDLARLIAADLFELEWVSAFEIECR
FT                   NEESIHLHDAYAKLCFSKEVDKI"
     MNQHTLLPKK TERLQYFGSV SPIKGEKPVE KEKMKDLQNI RKDYFFDIQH VGVANVSHPV        60
     TITSAMMPAE QTTAANFTMT CNLPRNQKGI NMSRLTELLQ VYHQNGWILS FSSLQQFTKE       120
     LAENMDTSSA TVEVRFPWFF ERKSPKLEKA GLMHADIFMS VTYRKDQPFK QRAGISAKVT       180
     TLCPCSKEIS EYSAHNQRGT VSIWADIHPA ASLPSDVKAD LLHAAESNAS ARLHPVLKRP       240
     DEKAVTETAY ENPRFVEDLA RLIAADLFEL EWVSAFEIEC RNEESIHLHD AYAKLCFSKE       300
     VDKI                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page