(data stored in SCRATCH zone)

EMBL: AL009126.FOLK

AL009126.FOLK        Location/Qualifiers
FT   CDS             86946..87449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="BSU_00790"
FT                   /old_locus_tag="BSU00790"
FT                   /product="7,8-dihydro-6-hydroxymethylpterin
FT                   pyrophosphokinase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.6.3"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 17029412; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00790"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11855"
FT                   /db_xref="GOA:P29252"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="SubtiList:BG10142"
FT                   /db_xref="UniProtKB/Swiss-Prot:P29252"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11855.1"
FT                   /translation="MNNIAYIALGSNIGDRETYLRQAVALLHQHAAVTVTKVSSIYETD
FT                   PVGYEDQAQFLNMAVEIKTSLNPFELLELTQQIENELGRTREVRWGPRTADLDILLFNR
FT                   ENIETEQLIVPHPRMYERLFVLAPLAEICQQVEKEATSAETDQEGVRVWKQKSGVDEFV
FT                   HSES"
     MNNIAYIALG SNIGDRETYL RQAVALLHQH AAVTVTKVSS IYETDPVGYE DQAQFLNMAV        60
     EIKTSLNPFE LLELTQQIEN ELGRTREVRW GPRTADLDIL LFNRENIETE QLIVPHPRMY       120
     ERLFVLAPLA EICQQVEKEA TSAETDQEGV RVWKQKSGVD EFVHSES                     167
//

If you have problems or comments...

PBIL Back to PBIL home page