(data stored in SCRATCH zone)

EMBL: AL009126.FOLP

AL009126.FOLP        Location/Qualifiers
FT   CDS             85737..86594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="BSU_00770"
FT                   /old_locus_tag="BSU00770"
FT                   /product="dihydropteroate synthase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.5.1.15"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 2123867, 11007651; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00770"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11853"
FT                   /db_xref="GOA:P28822"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="SubtiList:BG10140"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28822"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11853.1"
FT                   /translation="MAQHTIDQTQVIHTKPSALSYKEKTLVMGILNVTPDSFSDGGKYD
FT                   SLDKALLHAKEMIDDGAHIIDIGGESTRPGAECVSEDEEMSRVIPVIERITKELGVPIS
FT                   VDTYKASVADEAVKAGASIINDIWGAKHDPKMASVAAEHNVPIVLMHNRPERNYNDLLP
FT                   DMLSDLMESVKIAVEAGVDEKNIILDPGIGFAKTYHDNLAVMNKLEIFSGLGYPVLLAT
FT                   SRKRFIGRVLDLPPEERAEGTGATVCLGIQKGCDIVRVHDVKQIARMAKMMDAMLNKGG
FT                   VHHG"
     MAQHTIDQTQ VIHTKPSALS YKEKTLVMGI LNVTPDSFSD GGKYDSLDKA LLHAKEMIDD        60
     GAHIIDIGGE STRPGAECVS EDEEMSRVIP VIERITKELG VPISVDTYKA SVADEAVKAG       120
     ASIINDIWGA KHDPKMASVA AEHNVPIVLM HNRPERNYND LLPDMLSDLM ESVKIAVEAG       180
     VDEKNIILDP GIGFAKTYHD NLAVMNKLEI FSGLGYPVLL ATSRKRFIGR VLDLPPEERA       240
     EGTGATVCLG IQKGCDIVRV HDVKQIARMA KMMDAMLNKG GVHHG                       285
//

If you have problems or comments...

PBIL Back to PBIL home page