(data stored in ACNUC7421 zone)

EMBL: AL009126.FTSH

AL009126.FTSH        Location/Qualifiers
FT   CDS             76984..78897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="BSU_00690"
FT                   /old_locus_tag="BSU00690"
FT                   /product="ATP-dependent cytoplasmic membrane protease"
FT                   /function="16.13: Shape"
FT                   /function="16.9: Replicate"
FT                   /EC_number="3.4.24.-"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9076729, 9084181, 9287010,
FT                   9352926, 10851010, 10913836, 12533473, 24001521, 22720735;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00690"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11845"
FT                   /db_xref="GOA:P37476"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="SubtiList:BG10132"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37476"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9076729, 9084181, 9287010, 9352926, 10851010,
FT                   10913836, 12533473, 24001521, 22720735"
FT                   /protein_id="CAB11845.1"
FT                   /translation="MNRVFRNTIFYLLILLVVIGVVSYFQTSNPKTENMSYSTFIKNLD
FT                   DGKVDSVSVQPVRGVYEVKGQLKNYDKDQYFLTHVPEGKGADQIFNALKKTDVKVEPAQ
FT                   ETSGWVTFLTTIIPFVIIFILFFFLLNQAQGGGSRVMNFGKSKAKLYTEEKKRVKFKDV
FT                   AGADEEKQELVEVVEFLKDPRKFAELGARIPKGVLLVGPPGTGKTLLAKACAGEAGVPF
FT                   FSISGSDFVEMFVGVGASRVRDLFENAKKNAPCLIFIDEIDAVGRQRGAGLGGGHDERE
FT                   QTLNQLLVEMDGFSANEGIIIIAATNRADILDPALLRPGRFDRQITVDRPDVIGREAVL
FT                   KVHARNKPLDETVNLKSIAMRTPGFSGADLENLLNEAALVAARQNKKKIDARDIDEATD
FT                   RVIAGPAKKSRVISKKERNIVAYHEGGHTVIGLVLDEADMVHKVTIVPRGQAGGYAVML
FT                   PREDRYFQTKPELLDKIVGLLGGRVAEEIIFGEVSTGAHNDFQRATNIARRMVTEFGMS
FT                   EKLGPLQFGQSQGGQVFLGRDFNNEQNYSDQIAYEIDQEIQRIIKECYERAKQILTENR
FT                   DKLELIAQTLLKVETLDAEQIKHLIDHGTLPERNFSDDEKNDDVKVNILTKTEEKKDDT
FT                   KE"
     MNRVFRNTIF YLLILLVVIG VVSYFQTSNP KTENMSYSTF IKNLDDGKVD SVSVQPVRGV        60
     YEVKGQLKNY DKDQYFLTHV PEGKGADQIF NALKKTDVKV EPAQETSGWV TFLTTIIPFV       120
     IIFILFFFLL NQAQGGGSRV MNFGKSKAKL YTEEKKRVKF KDVAGADEEK QELVEVVEFL       180
     KDPRKFAELG ARIPKGVLLV GPPGTGKTLL AKACAGEAGV PFFSISGSDF VEMFVGVGAS       240
     RVRDLFENAK KNAPCLIFID EIDAVGRQRG AGLGGGHDER EQTLNQLLVE MDGFSANEGI       300
     IIIAATNRAD ILDPALLRPG RFDRQITVDR PDVIGREAVL KVHARNKPLD ETVNLKSIAM       360
     RTPGFSGADL ENLLNEAALV AARQNKKKID ARDIDEATDR VIAGPAKKSR VISKKERNIV       420
     AYHEGGHTVI GLVLDEADMV HKVTIVPRGQ AGGYAVMLPR EDRYFQTKPE LLDKIVGLLG       480
     GRVAEEIIFG EVSTGAHNDF QRATNIARRM VTEFGMSEKL GPLQFGQSQG GQVFLGRDFN       540
     NEQNYSDQIA YEIDQEIQRI IKECYERAKQ ILTENRDKLE LIAQTLLKVE TLDAEQIKHL       600
     IDHGTLPERN FSDDEKNDDV KVNILTKTEE KKDDTKE                                637
//

If you have problems or comments...

PBIL Back to PBIL home page