(data stored in ACNUC7421 zone)

EMBL: AL009126.GABD

AL009126.GABD        Location/Qualifiers
FT   CDS             442950..444338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="BSU_03910"
FT                   /old_locus_tag="BSU03910"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /function="16.8: Protect"
FT                   /EC_number="1.2.1.24"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12354229, 15590624, 9723923,
FT                   12123465, 24529384, 24809290, 25911692; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03910"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12199"
FT                   /db_xref="GOA:P94428"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="SubtiList:BG12044"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94428"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12354229, 15590624, 9723923, 12123465, 24529384,
FT                   24809290, 25911692"
FT                   /protein_id="CAB12199.1"
FT                   /translation="MPDQLTVYNPATGEEIKTIPQQSATEVEEAIERSHQAFKTWSKTS
FT                   ANERTSLLKKWYELIVEHKEELADLITKENGKPYQEAVGEVLYGAGYIEWFAEEAKRVY
FT                   GRTVPAPTTGKRIVVTRQPVGPVAAITPWNFPNAMITRKAAPALAAGCTFIIKPAPDTP
FT                   LSAYELARLAYEAGIPKDVLQVVIGDGEEIGNVFTSSPKIRKITFTGSTPVGKILMKNS
FT                   ADTVKHVSMELGGHAPLIVDEDADIDLAVEQAMASKYRNAGQTCVCANRLIVHESIKDE
FT                   FAAKLSEQVSKLKVGNGLEEGVNVGPIINKRGFEKIVSQIDDAVEKGAKVIAGGTYDRN
FT                   DDKGCYFVNPTVLTDVDTSMNIMHEETFGPVAPIVTFSDIDEAIQLANDTPYGLAAYFF
FT                   TENYRRGIYISENLEYGIIGWNDGGPSAVQAPFGGMKESGIGREGGSEGIEPYLETKYL
FT                   SIGL"
     MPDQLTVYNP ATGEEIKTIP QQSATEVEEA IERSHQAFKT WSKTSANERT SLLKKWYELI        60
     VEHKEELADL ITKENGKPYQ EAVGEVLYGA GYIEWFAEEA KRVYGRTVPA PTTGKRIVVT       120
     RQPVGPVAAI TPWNFPNAMI TRKAAPALAA GCTFIIKPAP DTPLSAYELA RLAYEAGIPK       180
     DVLQVVIGDG EEIGNVFTSS PKIRKITFTG STPVGKILMK NSADTVKHVS MELGGHAPLI       240
     VDEDADIDLA VEQAMASKYR NAGQTCVCAN RLIVHESIKD EFAAKLSEQV SKLKVGNGLE       300
     EGVNVGPIIN KRGFEKIVSQ IDDAVEKGAK VIAGGTYDRN DDKGCYFVNP TVLTDVDTSM       360
     NIMHEETFGP VAPIVTFSDI DEAIQLANDT PYGLAAYFFT ENYRRGIYIS ENLEYGIIGW       420
     NDGGPSAVQA PFGGMKESGI GREGGSEGIE PYLETKYLSI GL                          462
//

If you have problems or comments...

PBIL Back to PBIL home page