(data stored in ACNUC7421 zone)

EMBL: AL009126.GABR

AL009126.GABR        Location/Qualifiers
FT   CDS             complement(440025..441464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabR"
FT                   /locus_tag="BSU_03890"
FT                   /old_locus_tag="BSU03890"
FT                   /product="transcriptional regulator (GntR/MocR family) with
FT                   PLP binding site (GabR-GABA-PLP aldimine)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15223311, 24127574, 25388514,
FT                   27640111, 28348215, 28412355; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03890"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12197"
FT                   /db_xref="GOA:P94426"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:4MGR"
FT                   /db_xref="PDB:4N0B"
FT                   /db_xref="PDB:4TV7"
FT                   /db_xref="PDB:5T4J"
FT                   /db_xref="PDB:5T4K"
FT                   /db_xref="PDB:5X03"
FT                   /db_xref="SubtiList:BG12042"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94426"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15223311, 24127574, 25388514, 27640111, 28348215,
FT                   28412355"
FT                   /protein_id="CAB12197.1"
FT                   /translation="MDITITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKREL
FT                   AENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAEEHPPFALPDDLKEIHI
FT                   DQSDWISFSHMSSDTDHFPIKSWFRCEQKAASRSYRTLGDMSHPQGIYEVRAAITRLIS
FT                   LTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTI
FT                   MLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDY
FT                   DSEFTYDVDSIPALQSLDRFQNVIYMGTFSKSLLPGLRISYMVLPPELLRAYKQRGYDL
FT                   QTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGL
FT                   HFVTEFDTRRTEQDILSHAAGLQLEIFGMSRFNLKENKRQTGRPALIIGFARLKEEDIQ
FT                   EGVQRLFKAVYGHKKIPVTGD"
     MDITITLDRS EQADYIYQQI YQKLKKEILS RNLLPHSKVP SKRELAENLK VSVNSVNSAY        60
     QQLLAEGYLY AIERKGFFVE ELDMFSAEEH PPFALPDDLK EIHIDQSDWI SFSHMSSDTD       120
     HFPIKSWFRC EQKAASRSYR TLGDMSHPQG IYEVRAAITR LISLTRGVKC RPEQMIIGAG       180
     TQVLMQLLTE LLPKEAVYAM EEPGYRRMYQ LLKNAGKQVK TIMLDEKGMS IAEITRQQPD       240
     VLVTTPSHQF PSGTIMPVSR RIQLLNWAAE EPRRYIIEDD YDSEFTYDVD SIPALQSLDR       300
     FQNVIYMGTF SKSLLPGLRI SYMVLPPELL RAYKQRGYDL QTCSSLTQLT LQEFIESGEY       360
     QKHIKKMKQH YKEKRERLIT ALEAEFSGEV TVKGANAGLH FVTEFDTRRT EQDILSHAAG       420
     LQLEIFGMSR FNLKENKRQT GRPALIIGFA RLKEEDIQEG VQRLFKAVYG HKKIPVTGD        479
//

If you have problems or comments...

PBIL Back to PBIL home page