(data stored in SCRATCH zone)

EMBL: AL009126.GABT

AL009126.GABT        Location/Qualifiers
FT   CDS             441571..442881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="BSU_03900"
FT                   /old_locus_tag="BSU03900"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /function="16.8: Protect"
FT                   /EC_number="2.6.1.19"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 4590473, 12123465, 12354229,
FT                   15590624, 9723923, 19854901, 24529384; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03900"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12198"
FT                   /db_xref="GOA:P94427"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="SubtiList:BG12043"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94427"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:4590473, 12123465, 12354229, 15590624, 9723923,
FT                   19854901, 24529384"
FT                   /protein_id="CAB12198.1"
FT                   /translation="MSQTTASITTAQWQQKRDQFVSKGVSNGNRSLAVKGEGAELYDLD
FT                   GRRFIDFAGAIGTLNVGHSHPKVVEAVKRQAEELIHPGFNVMMYPTYIELAEKLCGIAP
FT                   GSHEKKAIFLNSGAEAVENAVKIARKYTKRQGVVSFTRGFHGRTNMTMSMTSKVKPYKF
FT                   GFGPFAPEVYQAPFPYYYQKPAGMSDESYDDMVIQAFNDFFIASVAPETVACVVMEPVQ
FT                   GEGGFIIPSKRFVQHVASFCKEHGIVFVADEIQTGFARTGTYFAIEHFDVVPDLITVSK
FT                   SLAAGLPLSGVIGRAEMLDAAAPGELGGTYAGSPLGCAAALAVLDIIEEEGLNERSEEI
FT                   GKIIEDKAYEWKQEFPFIGDIRRLGAMAAIEIVKDPDTREPDKTKAAAIAAYANQNGLL
FT                   LLTAGINGNIIRFLTPLVISDSLLNEGLSILEAGLRA"
     MSQTTASITT AQWQQKRDQF VSKGVSNGNR SLAVKGEGAE LYDLDGRRFI DFAGAIGTLN        60
     VGHSHPKVVE AVKRQAEELI HPGFNVMMYP TYIELAEKLC GIAPGSHEKK AIFLNSGAEA       120
     VENAVKIARK YTKRQGVVSF TRGFHGRTNM TMSMTSKVKP YKFGFGPFAP EVYQAPFPYY       180
     YQKPAGMSDE SYDDMVIQAF NDFFIASVAP ETVACVVMEP VQGEGGFIIP SKRFVQHVAS       240
     FCKEHGIVFV ADEIQTGFAR TGTYFAIEHF DVVPDLITVS KSLAAGLPLS GVIGRAEMLD       300
     AAAPGELGGT YAGSPLGCAA ALAVLDIIEE EGLNERSEEI GKIIEDKAYE WKQEFPFIGD       360
     IRRLGAMAAI EIVKDPDTRE PDKTKAAAIA AYANQNGLLL LTAGINGNII RFLTPLVISD       420
     SLLNEGLSIL EAGLRA                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page