(data stored in ACNUC7421 zone)

EMBL: AL009126.GAMA

AL009126.GAMA        Location/Qualifiers
FT   CDS             complement(256823..257572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gamA"
FT                   /locus_tag="BSU_02360"
FT                   /old_locus_tag="BSU02360"
FT                   /product="glucosamine-6-phosphate deaminase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.13: Shape"
FT                   /EC_number="3.5.99.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 23667565, 27002132; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02360"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12030"
FT                   /db_xref="GOA:O31458"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="SubtiList:BG12746"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31458"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:23667565, 27002132"
FT                   /protein_id="CAB12030.1"
FT                   /translation="MKILIAEHYEELCKLSAAIIKEQIQAKKDAVLGLATGSTPVGLYK
FT                   QLISDYQAGEIDFSKVTTFNLDEYAGLSPSHPQSYNHFMHEHLFQHINMQPDHIHIPQG
FT                   DNPQLEAACKVYEDLIRQAGGIDVQILGIGANGHIGFNEPGSDFEDRTRVVKLSESTIQ
FT                   ANARFFGGDPVLVPRLAISMGIKTIMEFSKHIVLLASGEEKADAIQKMAEGPVTTDVPA
FT                   SILQKHNHVTVIADYKAAQKLKSASFS"
     MKILIAEHYE ELCKLSAAII KEQIQAKKDA VLGLATGSTP VGLYKQLISD YQAGEIDFSK        60
     VTTFNLDEYA GLSPSHPQSY NHFMHEHLFQ HINMQPDHIH IPQGDNPQLE AACKVYEDLI       120
     RQAGGIDVQI LGIGANGHIG FNEPGSDFED RTRVVKLSES TIQANARFFG GDPVLVPRLA       180
     ISMGIKTIME FSKHIVLLAS GEEKADAIQK MAEGPVTTDV PASILQKHNH VTVIADYKAA       240
     QKLKSASFS                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page