(data stored in SCRATCH zone)

EMBL: AL009126.GAMP

AL009126.GAMP        Location/Qualifiers
FT   CDS             complement(254907..256802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gamP"
FT                   /locus_tag="BSU_02350"
FT                   /old_locus_tag="BSU02350"
FT                   /product="phosphotransferase system (PTS)
FT                   glucosamine-specific enzyme IICBA component"
FT                   /function="16.1: Circulate"
FT                   /EC_number="2.7.1.193"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 10627040, 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02350"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12029"
FT                   /db_xref="GOA:P39816"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011299"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="SubtiList:BG11014"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39816"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12029.1"
FT                   /translation="MFKKAFQILQQLGRALMTPVAVLPAAGLLLRFGDKDLLNIPIIKD
FT                   AGGVVFDNLPLIFAVGVAIGLAGGEGVAGLAAVIGYLILTVTLDNMGKLLGLQPPYEGA
FT                   EHLIDMGVFGGIIIGLLAAYLYKRFSSIELHPVLGFFSGKRFVPIITSVSSLVIGVIFS
FT                   FVWPLIQNGINAASSLIADSTVGLFFYATIYRLLIPFGLHHIFYTPFYFMMGEYTDPST
FT                   GNTVTGDLTRFFAGDPTAGRFMMGDFPYMIFCLPAVALAIIHTARPEKKKMISGVMISA
FT                   ALTSMLTGITEPVEFSFLFVAPVLYLINSILAGVIFVVCDLFHVRHGYTFSGGGIDYVL
FT                   NYGLSTNGWVVIPVGIVFAFIYYYLFRFAILKWNLKTPGRETDEDGQNEEKAPVAKDQL
FT                   AFHVLQALGGQQNIANLDACITRLRVTVHQPSQVCKDELKRLGAVGVLEVNNNFQAIFG
FT                   TKSDALKDDIKTIMAGGVPATAAALDTVTDKPLKPDSDETFIYPIKGETVSLGDVPDQV
FT                   FSEKMMGEGFAIIPSEGKVVAPADGEIVSIFPTKHAIGFMSAGGTEILIHVGIDTVKLN
FT                   GEGFEAHVTSGQAVKQGELLLTFDLNYIKQHAASAITPVIFTNTSEEDLKHIQMK"
     MFKKAFQILQ QLGRALMTPV AVLPAAGLLL RFGDKDLLNI PIIKDAGGVV FDNLPLIFAV        60
     GVAIGLAGGE GVAGLAAVIG YLILTVTLDN MGKLLGLQPP YEGAEHLIDM GVFGGIIIGL       120
     LAAYLYKRFS SIELHPVLGF FSGKRFVPII TSVSSLVIGV IFSFVWPLIQ NGINAASSLI       180
     ADSTVGLFFY ATIYRLLIPF GLHHIFYTPF YFMMGEYTDP STGNTVTGDL TRFFAGDPTA       240
     GRFMMGDFPY MIFCLPAVAL AIIHTARPEK KKMISGVMIS AALTSMLTGI TEPVEFSFLF       300
     VAPVLYLINS ILAGVIFVVC DLFHVRHGYT FSGGGIDYVL NYGLSTNGWV VIPVGIVFAF       360
     IYYYLFRFAI LKWNLKTPGR ETDEDGQNEE KAPVAKDQLA FHVLQALGGQ QNIANLDACI       420
     TRLRVTVHQP SQVCKDELKR LGAVGVLEVN NNFQAIFGTK SDALKDDIKT IMAGGVPATA       480
     AALDTVTDKP LKPDSDETFI YPIKGETVSL GDVPDQVFSE KMMGEGFAII PSEGKVVAPA       540
     DGEIVSIFPT KHAIGFMSAG GTEILIHVGI DTVKLNGEGF EAHVTSGQAV KQGELLLTFD       600
     LNYIKQHAAS AITPVIFTNT SEEDLKHIQM K                                      631
//

If you have problems or comments...

PBIL Back to PBIL home page