(data stored in SCRATCH zone)

EMBL: AL009126.GARD

AL009126.GARD        Location/Qualifiers
FT   CDS             274029..275561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garD"
FT                   /locus_tag="BSU_02510"
FT                   /old_locus_tag="BSU02510"
FT                   /product="D-galactarate dehydratase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="4.2.1.42"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 9772162; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02510"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12045"
FT                   /db_xref="GOA:P42240"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017654"
FT                   /db_xref="SubtiList:BG11163"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42240"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12045.2"
FT                   /translation="MAMNLRKNQAPLYIKVHEIDNTAIIVNDGGLPKGTVFSCGLVLEE
FT                   DVPQGHKVALTDLNQGDEIVRYGEVIGFADETIKRGSWIREALVRMPAPPALDDLPLAN
FT                   RVPQPRPPLEGYTFEGYRNADGSAGTKNILGITTSVQCVVGVLDYAVKRIKEELLPKYP
FT                   NVDDVVPLHHQYGCGVAINAPDAVIPIRTIQNLAKHPNFGGEVMVIGLGCEKLLPERIA
FT                   SENDDDILSLQDHRGFAAMIQSILEMAEERLIRLNSRTRVSCPVSDLVIGLQCGGSDAF
FT                   SGVTANPAVGYAADLLVRAGATVLFSEVTEVRDAIHLLTPRAVSEEVGQSLIKEMKWYD
FT                   SYLRRGDADRSANPSPGNKKGGLSNVVEKALGSVAKSGTSPISGVLGPGERAKQKGLLF
FT                   AATPASDFVCGTLQLAAGMNLQVFTTGRGTPYGLAAAPVLKVSTRHSLSEHWADLIDIN
FT                   AGRIATGEASIEDVGWEIFRTILDVASGRKQTWADRWGLHNDLCLFNPAPVT"
     MAMNLRKNQA PLYIKVHEID NTAIIVNDGG LPKGTVFSCG LVLEEDVPQG HKVALTDLNQ        60
     GDEIVRYGEV IGFADETIKR GSWIREALVR MPAPPALDDL PLANRVPQPR PPLEGYTFEG       120
     YRNADGSAGT KNILGITTSV QCVVGVLDYA VKRIKEELLP KYPNVDDVVP LHHQYGCGVA       180
     INAPDAVIPI RTIQNLAKHP NFGGEVMVIG LGCEKLLPER IASENDDDIL SLQDHRGFAA       240
     MIQSILEMAE ERLIRLNSRT RVSCPVSDLV IGLQCGGSDA FSGVTANPAV GYAADLLVRA       300
     GATVLFSEVT EVRDAIHLLT PRAVSEEVGQ SLIKEMKWYD SYLRRGDADR SANPSPGNKK       360
     GGLSNVVEKA LGSVAKSGTS PISGVLGPGE RAKQKGLLFA ATPASDFVCG TLQLAAGMNL       420
     QVFTTGRGTP YGLAAAPVLK VSTRHSLSEH WADLIDINAG RIATGEASIE DVGWEIFRTI       480
     LDVASGRKQT WADRWGLHND LCLFNPAPVT                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page