(data stored in ACNUC7421 zone)

EMBL: AL009126.GDH

AL009126.GDH         Location/Qualifiers
FT   CDS             445344..446129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdh"
FT                   /locus_tag="BSU_03930"
FT                   /old_locus_tag="BSU03930"
FT                   /product="forespore glucose 1-dehydrogenase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.1.1.47"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 2493633, 3141376, 6438057,
FT                   16912926; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03930"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12201"
FT                   /db_xref="GOA:P12310"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="SubtiList:BG10545"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12310"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:2493633, 3141376, 6438057, 16912926"
FT                   /protein_id="CAB12201.1"
FT                   /translation="MYPDLKGKVVAITGAASGLGKAMAIRFGKEQAKVVINYYSNKQDP
FT                   NEVKEEVIKAGGEAVVVQGDVTKEEDVKNIVQTAIKEFGTLDIMINNAGLENPVPSHEM
FT                   PLKDWDKVIGTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEVIPWPLFVHYAASKG
FT                   GIKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFADPKQKADVESMIPMGYIGEPE
FT                   EIAAVAAWLASKEASYVTGITLFADGGMTQYPSFQAGRG"
     MYPDLKGKVV AITGAASGLG KAMAIRFGKE QAKVVINYYS NKQDPNEVKE EVIKAGGEAV        60
     VVQGDVTKEE DVKNIVQTAI KEFGTLDIMI NNAGLENPVP SHEMPLKDWD KVIGTNLTGA       120
     FLGSREAIKY FVENDIKGNV INMSSVHEVI PWPLFVHYAA SKGGIKLMTE TLALEYAPKG       180
     IRVNNIGPGA INTPINAEKF ADPKQKADVE SMIPMGYIGE PEEIAAVAAW LASKEASYVT       240
     GITLFADGGM TQYPSFQAGR G                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page