(data stored in ACNUC7421 zone)

EMBL: AL009126.GERKA

AL009126.GERKA       Location/Qualifiers
FT   CDS             420110..421744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKA"
FT                   /locus_tag="BSU_03700"
FT                   /old_locus_tag="BSU03700"
FT                   /product="spore germination receptor subunit"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10762253, 16707705, 16740944;
FT                   Product type cp: cell process"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03700"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12178"
FT                   /db_xref="GOA:P49939"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="SubtiList:BG11392"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49939"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10762253, 16707705, 16740944"
FT                   /protein_id="CAB12178.1"
FT                   /translation="MPLFSKRKNNTDSKDKQNTDERNQEQQQEKERPVLISPSLAKNIA
FT                   ETKKEVGSSSDVIIREIKIGEQDHVHLAVIYISGLVDNNTIHESLIDPLVQDESIQNTH
FT                   AIQQILEKTLPLGGVKAEKSWDKLFSELMLGNALIFADGHDEALICSTQGGEQRSIQEP
FT                   STQVSFRGPRQGFTESLQTNISMIRRYIKNPNLWVEKMKKGSVTNTDIALMYIQGICDE
FT                   KVLKEVKQRLEKIDIDSILESGYIEQLIEDETFTTFPTMYHTERPDVVAGNLLEGRFAI
FT                   IVDGTPFVLIAPALFVQFFQSVEDYYSRFDIATSIRILRVLVFFISLVAPAVYVAATTF
FT                   HQEMIPTQLLVVIAAQREIVPFPAVVEALTMEVAFEILREAGVRLPRVVGSAVSIVGAL
FT                   VIGQAAVQAGIVSPAMVIIVALTAIASFATPAFAMAISARLIRFIFIIASAVMGFYGLI
FT                   LGIIMMFVHLCSLRSFGVPYMSPLAPFSSQGVKDALFRVPWWADEKRPESVSKEDKVRQ
FT                   GKDQRPEPAASRGMVNKDLEEGDQNGT"
     MPLFSKRKNN TDSKDKQNTD ERNQEQQQEK ERPVLISPSL AKNIAETKKE VGSSSDVIIR        60
     EIKIGEQDHV HLAVIYISGL VDNNTIHESL IDPLVQDESI QNTHAIQQIL EKTLPLGGVK       120
     AEKSWDKLFS ELMLGNALIF ADGHDEALIC STQGGEQRSI QEPSTQVSFR GPRQGFTESL       180
     QTNISMIRRY IKNPNLWVEK MKKGSVTNTD IALMYIQGIC DEKVLKEVKQ RLEKIDIDSI       240
     LESGYIEQLI EDETFTTFPT MYHTERPDVV AGNLLEGRFA IIVDGTPFVL IAPALFVQFF       300
     QSVEDYYSRF DIATSIRILR VLVFFISLVA PAVYVAATTF HQEMIPTQLL VVIAAQREIV       360
     PFPAVVEALT MEVAFEILRE AGVRLPRVVG SAVSIVGALV IGQAAVQAGI VSPAMVIIVA       420
     LTAIASFATP AFAMAISARL IRFIFIIASA VMGFYGLILG IIMMFVHLCS LRSFGVPYMS       480
     PLAPFSSQGV KDALFRVPWW ADEKRPESVS KEDKVRQGKD QRPEPAASRG MVNKDLEEGD       540
     QNGT                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page