(data stored in ACNUC7421 zone)

EMBL: AL009126.GERKB

AL009126.GERKB       Location/Qualifiers
FT   CDS             422982..424103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKB"
FT                   /locus_tag="BSU_03720"
FT                   /old_locus_tag="BSU03720"
FT                   /product="spore germination receptor subunit"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10762253, 15849754, 16707705,
FT                   16740944, 16850406, 19363077; Product type cp : cell
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03720"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12180"
FT                   /db_xref="GOA:P49940"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="SubtiList:BG11393"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49940"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10762253, 15849754, 16707705, 16740944, 16850406,
FT                   19363077"
FT                   /protein_id="CAB12180.1"
FT                   /translation="MEKARISIRQLFVMIIIFELGSSLLITPGSMAGRDAWIAVLLGCA
FT                   IGLFLFYLYQGIYQCYPNSSPKEYMDDMLGTKLSWLFSFLYILYFAYIAARVLRDFGEM
FT                   LLTFAYHDTPIIIVNALLMVVSIYAVRKGIEVLARAAELLFGAMYLLGAIGLVLIIVSG
FT                   TIDPHNLKPVLANGISPVLHSVFTQTMYVPFGEVVLFVMIFPNLNDRKDVKKMGMIAMA
FT                   ISGLIVALTVAINISVLDVDLTLRSQFPLLSTIQTIKVEEFLDRLDVFFMLALIIGGFF
FT                   KVSLYLYATVVGTSTLFKEKNPSQLAYPMGLGILILSITIATNFSEHLNEGLNVVPLYI
FT                   HLPFQLLFPLFLFIVAVWKKKRREKSKGEEAKK"
     MEKARISIRQ LFVMIIIFEL GSSLLITPGS MAGRDAWIAV LLGCAIGLFL FYLYQGIYQC        60
     YPNSSPKEYM DDMLGTKLSW LFSFLYILYF AYIAARVLRD FGEMLLTFAY HDTPIIIVNA       120
     LLMVVSIYAV RKGIEVLARA AELLFGAMYL LGAIGLVLII VSGTIDPHNL KPVLANGISP       180
     VLHSVFTQTM YVPFGEVVLF VMIFPNLNDR KDVKKMGMIA MAISGLIVAL TVAINISVLD       240
     VDLTLRSQFP LLSTIQTIKV EEFLDRLDVF FMLALIIGGF FKVSLYLYAT VVGTSTLFKE       300
     KNPSQLAYPM GLGILILSIT IATNFSEHLN EGLNVVPLYI HLPFQLLFPL FLFIVAVWKK       360
     KRREKSKGEE AKK                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page