(data stored in ACNUC7421 zone)

EMBL: AL009126.GERKC

AL009126.GERKC       Location/Qualifiers
FT   CDS             421734..422957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKC"
FT                   /locus_tag="BSU_03710"
FT                   /old_locus_tag="BSU03710"
FT                   /product="spore germination receptor subunit"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10762253, 16707705, 16740944,
FT                   19363077; Product type cp: cell process"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03710"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12179"
FT                   /db_xref="GOA:P49941"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="SubtiList:BG11394"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49941"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10762253, 16707705, 16740944, 19363077"
FT                   /protein_id="CAB12179.1"
FT                   /translation="MVRKCLLAVLMLLSVIVLPGCWDKRELTDLAIISAIGIDRTNDSN
FT                   YVLHLQIINPGNVAGGLQGGGAGDRPPVSVYSIEGNNITEALRKASMKVSRRLYFAHTN
FT                   LVVINEKLAKEEGLDFVLDNLDRDTEFRTTATFVVAHKTKAENIVKILTPIDKIPSNKV
FT                   NKTLDFTEAQYGRVVKINIQDVLKTLAANTMAPVIPGYMMIGDDKKGVSMENTQATDPK
FT                   AILQADGLAVFDKAGYLKYWLEDDESVGAVWLMNKIQHTFINADWGKTKDAVSLQVTHQ
FT                   DTKLVPKMRNGRPYIHVKVSVEGIIDAVKYPFQLSDPKVLAAIEKALNKELEKEISHTV
FT                   KKIKKNKIDFIGFGDTIYRKYPEQWEKMKDTWDKEYLPELPIDVKAETYIRRTGLRNNP
FT                   IKHQFKDD"
     MVRKCLLAVL MLLSVIVLPG CWDKRELTDL AIISAIGIDR TNDSNYVLHL QIINPGNVAG        60
     GLQGGGAGDR PPVSVYSIEG NNITEALRKA SMKVSRRLYF AHTNLVVINE KLAKEEGLDF       120
     VLDNLDRDTE FRTTATFVVA HKTKAENIVK ILTPIDKIPS NKVNKTLDFT EAQYGRVVKI       180
     NIQDVLKTLA ANTMAPVIPG YMMIGDDKKG VSMENTQATD PKAILQADGL AVFDKAGYLK       240
     YWLEDDESVG AVWLMNKIQH TFINADWGKT KDAVSLQVTH QDTKLVPKMR NGRPYIHVKV       300
     SVEGIIDAVK YPFQLSDPKV LAAIEKALNK ELEKEISHTV KKIKKNKIDF IGFGDTIYRK       360
     YPEQWEKMKD TWDKEYLPEL PIDVKAETYI RRTGLRNNPI KHQFKDD                     407
//

If you have problems or comments...

PBIL Back to PBIL home page