(data stored in ACNUC7421 zone)

EMBL: AL009126.GLCU

AL009126.GLCU        Location/Qualifiers
FT   CDS             444461..445324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcU"
FT                   /locus_tag="BSU_03920"
FT                   /old_locus_tag="BSU03920"
FT                   /product="glucose uptake protein"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 10438764, 15849754, 16850406,
FT                   19054326, 21564334, 27329749; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03920"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12200"
FT                   /db_xref="GOA:P40420"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="SubtiList:BG11066"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40420"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12200.1"
FT                   /translation="MDLLLALLPALFWGSIVLFNVKLGGGPYSQTLGTTIGALIVSIVI
FT                   YFFVQPVLSLRIFIVGIVSGLFWSLGQANQLKSIQLMGVSKTMPISTGMQLVSTSLFGV
FT                   IVFREWSTPIAITLGVLALIFIIVGIILTSLEDKNDKKEGEPSNLKKGILILLVSTLGY
FT                   LVYVVVARLFNVSGWSALLPQAIGMVVGGLVLTYRHKPFNKYAIRNILPGLIWAGGNMF
FT                   LFISQPRVGVATSFSLSQMGIVISTLGGIFILREKKTKRQLIAIAIGIILIIAAAVFLG
FT                   IAKTNS"
     MDLLLALLPA LFWGSIVLFN VKLGGGPYSQ TLGTTIGALI VSIVIYFFVQ PVLSLRIFIV        60
     GIVSGLFWSL GQANQLKSIQ LMGVSKTMPI STGMQLVSTS LFGVIVFREW STPIAITLGV       120
     LALIFIIVGI ILTSLEDKND KKEGEPSNLK KGILILLVST LGYLVYVVVA RLFNVSGWSA       180
     LLPQAIGMVV GGLVLTYRHK PFNKYAIRNI LPGLIWAGGN MFLFISQPRV GVATSFSLSQ       240
     MGIVISTLGG IFILREKKTK RQLIAIAIGI ILIIAAAVFL GIAKTNS                     287
//

If you have problems or comments...

PBIL Back to PBIL home page