(data stored in ACNUC7421 zone)

EMBL: AL009126.GLMM

AL009126.GLMM        Location/Qualifiers
FT   CDS             198497..199843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="BSU_01770"
FT                   /old_locus_tag="BSU01770"
FT                   /product="phosphoglucosamine mutase"
FT                   /function="16.6: Maintain"
FT                   /function="16.13: Shape"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="5.4.2.10"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10671448, 10913078, 12089032,
FT                   21154411, 26240071, 27074767; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01770"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11953"
FT                   /db_xref="GOA:O34824"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="SubtiList:BG12704"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34824"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10671448, 10913078, 12089032, 21154411, 26240071,
FT                   27074767"
FT                   /protein_id="CAB11953.1"
FT                   /translation="MGKYFGTDGVRGVANSELTPELAFKVGRFGGYVLTKDKQRPKVLI
FT                   GRDTRISGHMLEGALVAGLLSIGAEVMRLGVISTPGVSYLTKAMDAEAGVMISASHNPV
FT                   QDNGIKFFGGDGFKLSDEQEAEIERLMDEPEDKLPRPVGADLGLVNDYFEGGQKYLQFL
FT                   KQTADEDFTGIHVALDCANGATSSLATHLFADLDADVSTMGTSPNGLNINDGVGSTHPE
FT                   ALSAFVKEKNADLGLAFDGDGDRLIAVDEKGNIVDGDQIMYICSKHLKSEGRLKDDTVV
FT                   STVMSNLGFYKALEKEGIKSVQTAVGDRYVVEAMKKDGYNVGGEQSGHLIFLDYNTTGD
FT                   GLLSAIMLMNTLKATGKPLSELAAEMQKFPQLLVNVRVTDKYKVEENEKVKAVISEVEK
FT                   EMNGDGRILVRPSGTEPLVRVMAEAKTKELCDEYVNRIVEVVRSEMGLE"
     MGKYFGTDGV RGVANSELTP ELAFKVGRFG GYVLTKDKQR PKVLIGRDTR ISGHMLEGAL        60
     VAGLLSIGAE VMRLGVISTP GVSYLTKAMD AEAGVMISAS HNPVQDNGIK FFGGDGFKLS       120
     DEQEAEIERL MDEPEDKLPR PVGADLGLVN DYFEGGQKYL QFLKQTADED FTGIHVALDC       180
     ANGATSSLAT HLFADLDADV STMGTSPNGL NINDGVGSTH PEALSAFVKE KNADLGLAFD       240
     GDGDRLIAVD EKGNIVDGDQ IMYICSKHLK SEGRLKDDTV VSTVMSNLGF YKALEKEGIK       300
     SVQTAVGDRY VVEAMKKDGY NVGGEQSGHL IFLDYNTTGD GLLSAIMLMN TLKATGKPLS       360
     ELAAEMQKFP QLLVNVRVTD KYKVEENEKV KAVISEVEKE MNGDGRILVR PSGTEPLVRV       420
     MAEAKTKELC DEYVNRIVEV VRSEMGLE                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page