(data stored in SCRATCH zone)

EMBL: AL009126.GLMS

AL009126.GLMS        Location/Qualifiers
FT   CDS             200277..202079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="BSU_01780"
FT                   /old_locus_tag="BSU01780"
FT                   /product="L-glutamine-D-fructose-6-phosphate
FT                   amidotransferase"
FT                   /function="16.13: Shape"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.6.1.16"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299, 15029187, 17114942,
FT                   17283212, 17322533, 23874669; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01780"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11954"
FT                   /db_xref="GOA:P0CI73"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="SubtiList:BG10948"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CI73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11954.1"
FT                   /translation="MCGIVGYIGQLDAKEILLKGLEKLEYRGYDSAGIAVANEQGIHVF
FT                   KEKGRIADLREVVDANVEAKAGIGHTRWATHGEPSYLNAHPHQSALGRFTLVHNGVIEN
FT                   YVQLKQEYLQDVELKSDTDTEVVVQVIEQFVNGGLETEEAFRKTLTLLKGSYAIALFDN
FT                   DNRETIFVAKNKSPLLVGLGDTFNVVASDAMAMLQVTNEYVELMDKEMVIVTDDQVVIK
FT                   NLDGDVITRASYIAELDASDIEKGTYPHYMLKETDEQPVVMRKIIQTYQDENGKLSVPG
FT                   DIAAAVAEADRIYIIGCGTSYHAGLVGKQYIEMWANVPVEVHVASEFSYNMPLLSKKPL
FT                   FIFLSQSGETADSRAVLVQVKALGHKALTITNVPGSTLSREADYTLLLHAGPEIAVAST
FT                   KAYTAQIAVLAVLASVAADKNGINIGFDLVKELGIAANAMEALCDQKDEMEMIAREYLT
FT                   VSRNAFFIGRGLDYFVCVEGALKLKEISYIQAEGFAGGELKHGTIALIEQGTPVFALAT
FT                   QEHVNLSIRGNVKEVAARGANTCIISLKGLDDADDRFVLPEVNPALAPLVSVVPLQLIA
FT                   YYAALHRGCDVDKPRNLAKSVTVE"
     MCGIVGYIGQ LDAKEILLKG LEKLEYRGYD SAGIAVANEQ GIHVFKEKGR IADLREVVDA        60
     NVEAKAGIGH TRWATHGEPS YLNAHPHQSA LGRFTLVHNG VIENYVQLKQ EYLQDVELKS       120
     DTDTEVVVQV IEQFVNGGLE TEEAFRKTLT LLKGSYAIAL FDNDNRETIF VAKNKSPLLV       180
     GLGDTFNVVA SDAMAMLQVT NEYVELMDKE MVIVTDDQVV IKNLDGDVIT RASYIAELDA       240
     SDIEKGTYPH YMLKETDEQP VVMRKIIQTY QDENGKLSVP GDIAAAVAEA DRIYIIGCGT       300
     SYHAGLVGKQ YIEMWANVPV EVHVASEFSY NMPLLSKKPL FIFLSQSGET ADSRAVLVQV       360
     KALGHKALTI TNVPGSTLSR EADYTLLLHA GPEIAVASTK AYTAQIAVLA VLASVAADKN       420
     GINIGFDLVK ELGIAANAME ALCDQKDEME MIAREYLTVS RNAFFIGRGL DYFVCVEGAL       480
     KLKEISYIQA EGFAGGELKH GTIALIEQGT PVFALATQEH VNLSIRGNVK EVAARGANTC       540
     IISLKGLDDA DDRFVLPEVN PALAPLVSVV PLQLIAYYAA LHRGCDVDKP RNLAKSVTVE       600
//

If you have problems or comments...

PBIL Back to PBIL home page