(data stored in SCRATCH zone)

EMBL: AL009126.GLMU

AL009126.GLMU        Location/Qualifiers
FT   CDS             56352..57722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="BSU_00500"
FT                   /old_locus_tag="BSU00500"
FT                   /product="bifunctional glucosamine-1-phosphate
FT                   N-acetyltransferase/UDP-N-acetylglucosamine
FT                   pyrophosphorylase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.157"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1328164, 8522540, 9648743,
FT                   11124906, 20495944, 23485416, 24915076; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00500"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11826"
FT                   /db_xref="GOA:P14192"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="SubtiList:BG10113"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14192"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1328164, 8522540, 9648743, 11124906, 20495944,
FT                   23485416, 24915076"
FT                   /protein_id="CAB11826.1"
FT                   /translation="MDKRFAVVLAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDEALKLS
FT                   LSKLVTIVGHGAEEVKKQLGDKSEYALQAKQLGTAHAVKQAQPFLADEKGVTIVICGDT
FT                   PLLTAETMEQMLKEHTQREAKATILTAVAEDPTGYGRIIRSENGAVQKIVEHKDASEEE
FT                   RLVTEINTGTYCFDNEALFRAIDQVSNDNAQGEYYLPDVIEILKNEGETVAAYQTGNFQ
FT                   ETLGVNDRVALSQAEQFMKERINKRHMQNGVTLIDPMNTYISPDAVIGSDTVIYPGTVI
FT                   KGEVQIGEDTIIGPHTEIMNSAIGSRTVIKQSVVNHSKVGNDVNIGPFAHIRPDSVIGN
FT                   EVKIGNFVEIKKTQFGDRSKASHLSYVGDAEVGTDVNLGCGSITVNYDGKNKYLTKIED
FT                   GAFIGCNSNLVAPVTVGEGAYVAAGSTVTEDVPGKALAIARARQVNKDDYVKNIHKK"
     MDKRFAVVLA AGQGTRMKSK LYKVLHPVCG KPMVEHVVDE ALKLSLSKLV TIVGHGAEEV        60
     KKQLGDKSEY ALQAKQLGTA HAVKQAQPFL ADEKGVTIVI CGDTPLLTAE TMEQMLKEHT       120
     QREAKATILT AVAEDPTGYG RIIRSENGAV QKIVEHKDAS EEERLVTEIN TGTYCFDNEA       180
     LFRAIDQVSN DNAQGEYYLP DVIEILKNEG ETVAAYQTGN FQETLGVNDR VALSQAEQFM       240
     KERINKRHMQ NGVTLIDPMN TYISPDAVIG SDTVIYPGTV IKGEVQIGED TIIGPHTEIM       300
     NSAIGSRTVI KQSVVNHSKV GNDVNIGPFA HIRPDSVIGN EVKIGNFVEI KKTQFGDRSK       360
     ASHLSYVGDA EVGTDVNLGC GSITVNYDGK NKYLTKIEDG AFIGCNSNLV APVTVGEGAY       420
     VAAGSTVTED VPGKALAIAR ARQVNKDDYV KNIHKK                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page