(data stored in ACNUC7421 zone)

EMBL: AL009126.GLNJ

AL009126.GLNJ        Location/Qualifiers
FT   CDS             265476..266708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnJ"
FT                   /locus_tag="BSU_02440"
FT                   /old_locus_tag="BSU02440"
FT                   /product="two-component sensor histidine kinase [GlnL] for
FT                   glutamine degradation"
FT                   /function="16.12: Sense"
FT                   /function="16.3: Control"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11717295, 15995196, 17001076,
FT                   21435182, 23461034, 25691471; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02440"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12038"
FT                   /db_xref="GOA:P40758"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="SubtiList:BG10871"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40758"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11717295, 15995196, 17001076, 21435182, 23461034,
FT                   25691471"
FT                   /protein_id="CAB12038.2"
FT                   /translation="MLITVPLAGELKFYPLNEEFRVSFGAPVFFFFLSLLRHVPAVLPG
FT                   FLTGAAVFIFRVFLELWGGGHNGLTPILYDQASGFFFYMTYACLFSILKANRFRERPIM
FT                   LGFIGFMIEVVSDCVELTVQFLIFHTVVTPEKITDIAVIAISHTFIVMSFYSVLKLYET
FT                   QSREKQTRQQHEHMLMIVSNLYEETVHLKKTLKTTEKVTNDSYQLYREMKGKDVQLSGR
FT                   ILRLAGEIHEVKKDNQRIFAGLSKLISNESLRDYMRASDLLQLVIRMNEKYAEALGKQI
FT                   DFYCSIEGEHDEYHVFIVLSIINNLTANAVEAMDEEGMVSLRLRKPNESMVEFQVEDNG
FT                   PGISEKIGDIVFDPGFTSKYDEFGTPSTGIGLSYVKEIVTELEGDITFDNQQRGVVFAI
FT                   RLPVRHLIQKG"
     MLITVPLAGE LKFYPLNEEF RVSFGAPVFF FFLSLLRHVP AVLPGFLTGA AVFIFRVFLE        60
     LWGGGHNGLT PILYDQASGF FFYMTYACLF SILKANRFRE RPIMLGFIGF MIEVVSDCVE       120
     LTVQFLIFHT VVTPEKITDI AVIAISHTFI VMSFYSVLKL YETQSREKQT RQQHEHMLMI       180
     VSNLYEETVH LKKTLKTTEK VTNDSYQLYR EMKGKDVQLS GRILRLAGEI HEVKKDNQRI       240
     FAGLSKLISN ESLRDYMRAS DLLQLVIRMN EKYAEALGKQ IDFYCSIEGE HDEYHVFIVL       300
     SIINNLTANA VEAMDEEGMV SLRLRKPNES MVEFQVEDNG PGISEKIGDI VFDPGFTSKY       360
     DEFGTPSTGI GLSYVKEIVT ELEGDITFDN QQRGVVFAIR LPVRHLIQKG                  410
//

If you have problems or comments...

PBIL Back to PBIL home page