(data stored in SCRATCH zone)

EMBL: AL009126.GLPQA

AL009126.GLPQA       Location/Qualifiers
FT   CDS             complement(233014..233895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQA"
FT                   /locus_tag="BSU_02130"
FT                   /old_locus_tag="BSU02130"
FT                   /product="secreted glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.1.4.46"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10913081, 21966272; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02130"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12007"
FT                   /db_xref="GOA:P37965"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="PDB:5T91"
FT                   /db_xref="PDB:5T9B"
FT                   /db_xref="PDB:5T9C"
FT                   /db_xref="SubtiList:BG10646"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37965"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10913081, 21966272"
FT                   /protein_id="CAB12007.1"
FT                   /translation="MRKNRILALFVLSLGLLSFMVTPVSAASKGNLLSPDRILTVAHRG
FT                   ASGYVPEHTILSYETAQKMKADFIELDLQMTKDGKLIVMHDEKLDRTTNGMGWVKDHTL
FT                   ADIKKLDAGSWFNEAYPEKAKPQYVGLKVPTLEEVLDRFGKHANYYIETKSPDTYPGME
FT                   EKLIASLQKHKLLGKHSKPGQVIIQSFSKESLVKVHQLQPNLPTVQLLEAKQMASMTDA
FT                   ALEEIKTYAVGAGPDYKALNQENVRMIRSHGLLLHPYTVNNEADMHRLLDWGVTGVFTN
FT                   YPDLFHKVKKGY"
     MRKNRILALF VLSLGLLSFM VTPVSAASKG NLLSPDRILT VAHRGASGYV PEHTILSYET        60
     AQKMKADFIE LDLQMTKDGK LIVMHDEKLD RTTNGMGWVK DHTLADIKKL DAGSWFNEAY       120
     PEKAKPQYVG LKVPTLEEVL DRFGKHANYY IETKSPDTYP GMEEKLIASL QKHKLLGKHS       180
     KPGQVIIQSF SKESLVKVHQ LQPNLPTVQL LEAKQMASMT DAALEEIKTY AVGAGPDYKA       240
     LNQENVRMIR SHGLLLHPYT VNNEADMHRL LDWGVTGVFT NYPDLFHKVK KGY              293
//

If you have problems or comments...

PBIL Back to PBIL home page