(data stored in SCRATCH zone)

EMBL: AL009126.GLSA

AL009126.GLSA        Location/Qualifiers
FT   CDS             complement(264191..265174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glsA"
FT                   /locus_tag="BSU_02430"
FT                   /old_locus_tag="BSU02430"
FT                   /product="glutaminase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.5.1.2"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15995196, 18459799, 20050917;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02430"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12037"
FT                   /db_xref="GOA:O31465"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="PDB:1MKI"
FT                   /db_xref="PDB:2OSU"
FT                   /db_xref="PDB:3AGF"
FT                   /db_xref="PDB:3BRM"
FT                   /db_xref="SubtiList:BG12753"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31465"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15995196, 18459799, 20050917"
FT                   /protein_id="CAB12037.1"
FT                   /translation="MKELIKEHQKDINPALQLHDWVEYYRPFAANGQSANYIPALGKVN
FT                   DSQLGICVLEPDGTMIHAGDWNVSFTMQSISKVISFIAACMSRGIPYVLDRVDVEPTGD
FT                   AFNSIIRLEINKPGKPFNPMINAGALTIASILPGESAYEKLEFLYSVMETLIGKRPRIH
FT                   EEVFRSEWETAHRNRALAYYLKETNFLEAEVEETLEVYLKQCAMESTTEDIALIGLILA
FT                   HDGYHPIRHEQVIPKDVAKLAKALMLTCGMYNASGKYAAFVGVPAKSGVSGGIMALVPP
FT                   SARREQPFQSGCGIGIYGPAIDEYGNSLTGGMLLKHMAQEWELSIF"
     MKELIKEHQK DINPALQLHD WVEYYRPFAA NGQSANYIPA LGKVNDSQLG ICVLEPDGTM        60
     IHAGDWNVSF TMQSISKVIS FIAACMSRGI PYVLDRVDVE PTGDAFNSII RLEINKPGKP       120
     FNPMINAGAL TIASILPGES AYEKLEFLYS VMETLIGKRP RIHEEVFRSE WETAHRNRAL       180
     AYYLKETNFL EAEVEETLEV YLKQCAMEST TEDIALIGLI LAHDGYHPIR HEQVIPKDVA       240
     KLAKALMLTC GMYNASGKYA AFVGVPAKSG VSGGIMALVP PSARREQPFQ SGCGIGIYGP       300
     AIDEYGNSLT GGMLLKHMAQ EWELSIF                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page