(data stored in SCRATCH zone)

EMBL: AL009126.GLTP

AL009126.GLTP        Location/Qualifiers
FT   CDS             complement(253518..254762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltP"
FT                   /locus_tag="BSU_02340"
FT                   /old_locus_tag="BSU02340"
FT                   /product="proton/glutamate symport protein"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7751298, 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02340"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12028"
FT                   /db_xref="GOA:P39817"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="SubtiList:BG11015"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39817"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7751298, 15849754, 16850406"
FT                   /protein_id="CAB12028.1"
FT                   /translation="MKKLIAFQILIALAVGAVIGHFFPDFGMALRPVGDGFIRLIKMIV
FT                   VPIVFSTIVIGAAGSGSMKKMGSLGIKTIIWFEVITTLVLGLGLLLANVLKPGVGLDLS
FT                   HLAKKDIHELSGYTDKVVDFKQMILDIIPTNIIDVMARNDLLAVIFFAILFGVAAAGIG
FT                   KASEPVMKFFESTAQIMFKLTQIVMVTAPIGVLALMAASVGQYGIELLLPMFKLVGTVF
FT                   LGLFLILFVLFPLVGLIFQIKYFEVLKMIWDLFLIAFSTTSTETILPQLMDRMEKYGCP
FT                   KRVVSFVVPSGLSLNCDGSSLYLSVSCIFLAQAFQVDMTLSQQLLMMLVLVMTSKGIAA
FT                   VPSGSLVVLLATANAVGLPAEGVAIIAGVDRVMDMARTGVNVPGHAIACIVVSKWEKAF
FT                   RQKEWVSANSQTESI"
     MKKLIAFQIL IALAVGAVIG HFFPDFGMAL RPVGDGFIRL IKMIVVPIVF STIVIGAAGS        60
     GSMKKMGSLG IKTIIWFEVI TTLVLGLGLL LANVLKPGVG LDLSHLAKKD IHELSGYTDK       120
     VVDFKQMILD IIPTNIIDVM ARNDLLAVIF FAILFGVAAA GIGKASEPVM KFFESTAQIM       180
     FKLTQIVMVT APIGVLALMA ASVGQYGIEL LLPMFKLVGT VFLGLFLILF VLFPLVGLIF       240
     QIKYFEVLKM IWDLFLIAFS TTSTETILPQ LMDRMEKYGC PKRVVSFVVP SGLSLNCDGS       300
     SLYLSVSCIF LAQAFQVDMT LSQQLLMMLV LVMTSKGIAA VPSGSLVVLL ATANAVGLPA       360
     EGVAIIAGVD RVMDMARTGV NVPGHAIACI VVSKWEKAFR QKEWVSANSQ TESI             414
//

If you have problems or comments...

PBIL Back to PBIL home page