(data stored in SCRATCH zone)

EMBL: AL009126.GLTX

AL009126.GLTX        Location/Qualifiers
FT   CDS             111047..112498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="BSU_00920"
FT                   /old_locus_tag="BSU00920"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="6.1.1.17"
FT                   /EC_number="6.1.1.24"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 2120226, 3079749, 9342321,
FT                   10024179, 10546897, 12682299, 14741355; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00920"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11868"
FT                   /db_xref="GOA:P22250"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="SubtiList:BG10154"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22250"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:2120226, 3079749, 9342321, 10024179, 10546897,
FT                   12682299, 14741355"
FT                   /protein_id="CAB11868.1"
FT                   /translation="MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARNQGGKFIIRVED
FT                   TDKKRNIEGGEQSQLNYLKWLGIDWDESVDVGGEYGPYRQSERNDIYKVYYEELLEKGL
FT                   AYKCYCTEEELEKEREEQIARGEMPRYSGKHRDLTQEEQEKFIAEGRKPSIRFRVPEGK
FT                   VIAFNDIVKGEISFESDGIGDFVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNT
FT                   PKQIMIYQAFGWDIPQFGHMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEALFNFI
FT                   GLLGWSPVGEEELFTKEQFIEIFDVNRLSKSPALFDMHKLKWVNNQYVKKLDLDQVVEL
FT                   TLPHLQKAGKVGTELSAEEQEWVRKLISLYHEQLSYGAEIVELTDLFFTDEIEYNQEAK
FT                   AVLEEEQVPEVLSTFAAKLEELEEFTPDNIKASIKAVQKETGHKGKKLFMPIRVAVTGQ
FT                   THGPELPQSIELIGKETAIQRLKNI"
     MGNEVRVRYA PSPTGHLHIG NARTALFNYL FARNQGGKFI IRVEDTDKKR NIEGGEQSQL        60
     NYLKWLGIDW DESVDVGGEY GPYRQSERND IYKVYYEELL EKGLAYKCYC TEEELEKERE       120
     EQIARGEMPR YSGKHRDLTQ EEQEKFIAEG RKPSIRFRVP EGKVIAFNDI VKGEISFESD       180
     GIGDFVIVKK DGTPTYNFAV AIDDYLMKMT HVLRGEDHIS NTPKQIMIYQ AFGWDIPQFG       240
     HMTLIVNESR KKLSKRDESI IQFIEQYKEL GYLPEALFNF IGLLGWSPVG EEELFTKEQF       300
     IEIFDVNRLS KSPALFDMHK LKWVNNQYVK KLDLDQVVEL TLPHLQKAGK VGTELSAEEQ       360
     EWVRKLISLY HEQLSYGAEI VELTDLFFTD EIEYNQEAKA VLEEEQVPEV LSTFAAKLEE       420
     LEEFTPDNIK ASIKAVQKET GHKGKKLFMP IRVAVTGQTH GPELPQSIEL IGKETAIQRL       480
     KNI                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page