(data stored in ACNUC7421 zone)

EMBL: AL009126.GSIB

AL009126.GSIB        Location/Qualifiers
FT   CDS             494506..494877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsiB"
FT                   /locus_tag="BSU_04400"
FT                   /old_locus_tag="BSU04400"
FT                   /product="general stress protein glucose starvation
FT                   induced"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7651322, 9669336, 9763714,
FT                   12562800, 21421783; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04400"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12247"
FT                   /db_xref="InterPro:IPR019626"
FT                   /db_xref="SubtiList:BG10826"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26907"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7651322, 9669336, 9763714, 12562800, 21421783"
FT                   /protein_id="CAB12247.1"
FT                   /translation="MADNNKMSREEAGRKGGETTSKNHDKEFYQEIGQKGGEATSKNHD
FT                   KEFYQEIGEKGGEATSKNHDKEFYQEIGEKGGEATSENHDKEFYQEIGRKGGEATSKNH
FT                   DKEFYQEIGSKGGNARNND"
     MADNNKMSRE EAGRKGGETT SKNHDKEFYQ EIGQKGGEAT SKNHDKEFYQ EIGEKGGEAT        60
     SKNHDKEFYQ EIGEKGGEAT SENHDKEFYQ EIGRKGGEAT SKNHDKEFYQ EIGSKGGNAR       120
     NND                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page