(data stored in ACNUC7421 zone)

EMBL: AL009126.GUAB

AL009126.GUAB        Location/Qualifiers
FT   CDS             15915..17381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="BSU_00090"
FT                   /old_locus_tag="BSU00090"
FT                   /product="inosine-monophosphate dehydrogenase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="1.1.1.205"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 1722815, 17611193,
FT                   1979163, 3125411, 8917437; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00090"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11785"
FT                   /db_xref="GOA:P21879"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="SubtiList:BG10073"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21879"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 1722815, 17611193, 1979163, 3125411,
FT                   8917437"
FT                   /protein_id="CAB11785.1"
FT                   /translation="MWESKFSKEGLTFDDVLLVPAKSEVLPRDVDLSVELTKTLKLNIP
FT                   VISAGMDTVTESAMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSERGVITNPFFLTP
FT                   DHQVFDAEHLMGKYRISGVPIVNNEEDQKLVGIITNRDLRFISDYSMKISDVMTKEELV
FT                   TASVGTTLDEAEKILQKHKIEKLPLVDDQNKLKGLITIKDIEKVIEFPNSSKDIHGRLI
FT                   VGAAVGVTGDTMTRVKKLVEANVDVIVIDTAHGHSQGVLNTVTKIRETYPELNIIAGNV
FT                   ATAEATRALIEAGADVVKVGIGPGSICTTRVVAGVGVPQITAIYDCATEARKHGKTIIA
FT                   DGGIKFSGDITKALAAGGHAVMLGSLLAGTSESPGETEIYQGRRFKVYRGMGSVAAMEK
FT                   GSKDRYFQEENKKFVPEGIEGRTPYKGPVEETVYQLVGGLRSGMGYCGSKDLRALREEA
FT                   QFIRMTGAGLRESHPHDVQITKESPNYTIS"
     MWESKFSKEG LTFDDVLLVP AKSEVLPRDV DLSVELTKTL KLNIPVISAG MDTVTESAMA        60
     IAMARQGGLG IIHKNMSIEQ QAEQVDKVKR SERGVITNPF FLTPDHQVFD AEHLMGKYRI       120
     SGVPIVNNEE DQKLVGIITN RDLRFISDYS MKISDVMTKE ELVTASVGTT LDEAEKILQK       180
     HKIEKLPLVD DQNKLKGLIT IKDIEKVIEF PNSSKDIHGR LIVGAAVGVT GDTMTRVKKL       240
     VEANVDVIVI DTAHGHSQGV LNTVTKIRET YPELNIIAGN VATAEATRAL IEAGADVVKV       300
     GIGPGSICTT RVVAGVGVPQ ITAIYDCATE ARKHGKTIIA DGGIKFSGDI TKALAAGGHA       360
     VMLGSLLAGT SESPGETEIY QGRRFKVYRG MGSVAAMEKG SKDRYFQEEN KKFVPEGIEG       420
     RTPYKGPVEE TVYQLVGGLR SGMGYCGSKD LRALREEAQF IRMTGAGLRE SHPHDVQITK       480
     ESPNYTIS                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page