(data stored in SCRATCH zone)

EMBL: AL009126.GUCD

AL009126.GUCD        Location/Qualifiers
FT   CDS             268846..270312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gucD"
FT                   /locus_tag="BSU_02470"
FT                   /old_locus_tag="BSU02470"
FT                   /product="2,5-dioxovalerate dehydrogenase
FT                   (alpha-ketoglutaric semialdehyde dehydrogenase)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.2.1.26"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12044674, 17202142; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02470"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12041"
FT                   /db_xref="GOA:P42236"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="SubtiList:BG11159"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42236"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12041.1"
FT                   /translation="MSVITEQNTYLNFINGEWVKSQSGDMVKVENPADVNDIVGYVQNS
FT                   TAEDVERAVTAANEAKTAWRKLTGAERGQYLYKTADIMEQRLEEIAACATREMGKTLPE
FT                   AKGETARGIAILRYYAGEGMRKTGDVIPSTDKDALMFTTRVPLGVVGVISPWNFPVAIP
FT                   IWKMAPALVYGNTVVIKPATETAVTCAKIIACFEEAGLPAGVINLVTGPGSVVGQGLAE
FT                   HDGVNAVTFTGSNQVGKIIGQAALARGAKYQLEMGGKNPVIVADDADLEAAAEAVITGA
FT                   FRSTGQKCTATSRVIVQSGIYERFKEKLLQRTKDITIGDSLKEDVWMGPIASKNQLDNC
FT                   LSYIEKGKQEGASLLIGGEKLENGKYQNGYYVQPAIFDNVTSEMTIAQEEIFGPVIALI
FT                   KVDSIEEALNIANDVKFGLSASIFTENIGRMLSFIDEIDAGLVRINAESAGVELQAPFG
FT                   GMKQSSSHSREQGEAAKDFFTAIKTVFVKP"
     MSVITEQNTY LNFINGEWVK SQSGDMVKVE NPADVNDIVG YVQNSTAEDV ERAVTAANEA        60
     KTAWRKLTGA ERGQYLYKTA DIMEQRLEEI AACATREMGK TLPEAKGETA RGIAILRYYA       120
     GEGMRKTGDV IPSTDKDALM FTTRVPLGVV GVISPWNFPV AIPIWKMAPA LVYGNTVVIK       180
     PATETAVTCA KIIACFEEAG LPAGVINLVT GPGSVVGQGL AEHDGVNAVT FTGSNQVGKI       240
     IGQAALARGA KYQLEMGGKN PVIVADDADL EAAAEAVITG AFRSTGQKCT ATSRVIVQSG       300
     IYERFKEKLL QRTKDITIGD SLKEDVWMGP IASKNQLDNC LSYIEKGKQE GASLLIGGEK       360
     LENGKYQNGY YVQPAIFDNV TSEMTIAQEE IFGPVIALIK VDSIEEALNI ANDVKFGLSA       420
     SIFTENIGRM LSFIDEIDAG LVRINAESAG VELQAPFGGM KQSSSHSREQ GEAAKDFFTA       480
     IKTVFVKP                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page