(data stored in SCRATCH zone)

EMBL: AL009126.GUDD

AL009126.GUDD        Location/Qualifiers
FT   CDS             271800..273167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gudD"
FT                   /locus_tag="BSU_02490"
FT                   /old_locus_tag="BSU02490"
FT                   /product="glucarate dehydratase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="4.2.1.40"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 9772161, 12044674; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02490"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12043"
FT                   /db_xref="GOA:P42238"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR017653"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="SubtiList:BG11161"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42238"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12043.2"
FT                   /translation="MSSPIQEQVQKEKRSNIPSISEMKVIPVAGHDSMLLNLSGAHSPF
FT                   FTRNIVILTDSSGNQGVGEVPGGEHIRRTLELSEPLVVGKSIGAYQAILQTVRKQFGDQ
FT                   DRGGRGNQTFDLRTTVHAVTALEAALLDLLGKFLQEPVAALLGEGKQRDEVKMLGYLFY
FT                   IGDRNRTTLPYQSDEQSDCAWFRLRHEEALTPEAIVRLAESAQERYGFQDFKLKGGVLR
FT                   GEEEIEAVTALSKRFPEARITLDPNGAWSLEEAIALCKGKQDVLAYAEDPCGDENGYSA
FT                   REVMAEFRRATGLPTATNMIATDWREMGHAIQLHAVDIPLADPHFWTMQGSVRVAQMCH
FT                   DWGLTWGSHSNNHFDISLAMFTHVAAAAPGRITAIDTHWIWQDGQRLTKQPFEISSGCV
FT                   KVPDKPGLGVDIDMEQVEKAHEIYRKMNLGARNDAIPMQFLISNWEFDRKRPCLVR"
     MSSPIQEQVQ KEKRSNIPSI SEMKVIPVAG HDSMLLNLSG AHSPFFTRNI VILTDSSGNQ        60
     GVGEVPGGEH IRRTLELSEP LVVGKSIGAY QAILQTVRKQ FGDQDRGGRG NQTFDLRTTV       120
     HAVTALEAAL LDLLGKFLQE PVAALLGEGK QRDEVKMLGY LFYIGDRNRT TLPYQSDEQS       180
     DCAWFRLRHE EALTPEAIVR LAESAQERYG FQDFKLKGGV LRGEEEIEAV TALSKRFPEA       240
     RITLDPNGAW SLEEAIALCK GKQDVLAYAE DPCGDENGYS AREVMAEFRR ATGLPTATNM       300
     IATDWREMGH AIQLHAVDIP LADPHFWTMQ GSVRVAQMCH DWGLTWGSHS NNHFDISLAM       360
     FTHVAAAAPG RITAIDTHWI WQDGQRLTKQ PFEISSGCVK VPDKPGLGVD IDMEQVEKAH       420
     EIYRKMNLGA RNDAIPMQFL ISNWEFDRKR PCLVR                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page