(data stored in ACNUC7421 zone)

EMBL: AL009126.GYRB

AL009126.GYRB        Location/Qualifiers
FT   CDS             4867..6783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BSU_00060"
FT                   /old_locus_tag="BSU00060"
FT                   /product="DNA gyrase (subunit B)"
FT                   /function="16.9: Replicate"
FT                   /function="16.3: Control"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="5.99.1.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 12767818, 17320901;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00060"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11782"
FT                   /db_xref="GOA:P05652"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="SubtiList:BG10070"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05652"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 12767818, 17320901"
FT                   /protein_id="CAB11782.1"
FT                   /translation="MEQQQNSYDENQIQVLEGLEAVRKRPGMYIGSTNSKGLHHLVWEI
FT                   VDNSIDEALAGYCTDINIQIEKDNSITVVDNGRGIPVGIHEKMGRPAVEVIMTVLHAGG
FT                   KFDGSGYKVSGGLHGVGASVVNALSTELDVTVHRDGKIHRQTYKRGVPVTDLEIIGETD
FT                   HTGTTTHFVPDPEIFSETTEYDYDLLANRVRELAFLTKGVNITIEDKREGQERKNEYHY
FT                   EGGIKSYVEYLNRSKEVVHEEPIYIEGEKDGITVEVALQYNDSYTSNIYSFTNNINTYE
FT                   GGTHEAGFKTGLTRVINDYARKKGLIKENDPNLSGDDVREGLTAIISIKHPDPQFEGQT
FT                   KTKLGNSEARTITDTLFSTAMETFMLENPDAAKKIVDKGLMAARARMAAKKARELTRRK
FT                   SALEISNLPGKLADCSSKDPSISELYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNVE
FT                   KARLDKILSNNEVRSMITALGTGIGEDFNLEKARYHKVVIMTDADVDGAHIRTLLLTFF
FT                   YRYMRQIIENGYVYIAQPPLYKVQQGKRVEYAYNDKELEELLKTLPQTPKPGLQRYKGL
FT                   GEMNATQLWETTMDPSSRTLLQVTLEDAMDADETFEMLMGDKVEPRRNFIEANARYVKN
FT                   LDI"
     MEQQQNSYDE NQIQVLEGLE AVRKRPGMYI GSTNSKGLHH LVWEIVDNSI DEALAGYCTD        60
     INIQIEKDNS ITVVDNGRGI PVGIHEKMGR PAVEVIMTVL HAGGKFDGSG YKVSGGLHGV       120
     GASVVNALST ELDVTVHRDG KIHRQTYKRG VPVTDLEIIG ETDHTGTTTH FVPDPEIFSE       180
     TTEYDYDLLA NRVRELAFLT KGVNITIEDK REGQERKNEY HYEGGIKSYV EYLNRSKEVV       240
     HEEPIYIEGE KDGITVEVAL QYNDSYTSNI YSFTNNINTY EGGTHEAGFK TGLTRVINDY       300
     ARKKGLIKEN DPNLSGDDVR EGLTAIISIK HPDPQFEGQT KTKLGNSEAR TITDTLFSTA       360
     METFMLENPD AAKKIVDKGL MAARARMAAK KARELTRRKS ALEISNLPGK LADCSSKDPS       420
     ISELYIVEGD SAGGSAKQGR DRHFQAILPL RGKILNVEKA RLDKILSNNE VRSMITALGT       480
     GIGEDFNLEK ARYHKVVIMT DADVDGAHIR TLLLTFFYRY MRQIIENGYV YIAQPPLYKV       540
     QQGKRVEYAY NDKELEELLK TLPQTPKPGL QRYKGLGEMN ATQLWETTMD PSSRTLLQVT       600
     LEDAMDADET FEMLMGDKVE PRRNFIEANA RYVKNLDI                               638
//

If you have problems or comments...

PBIL Back to PBIL home page