(data stored in ACNUC7421 zone)

EMBL: AL009126.HPRT

AL009126.HPRT        Location/Qualifiers
FT   CDS             76344..76886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprT"
FT                   /locus_tag="BSU_00680"
FT                   /old_locus_tag="BSU00680"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="2.4.2.8"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 3110131, 6408059, 24001521;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00680"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11844"
FT                   /db_xref="GOA:P37472"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="SubtiList:BG10131"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37472"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:3110131, 6408059, 24001521"
FT                   /protein_id="CAB11844.1"
FT                   /translation="MMKHDIEKVLISEEEIQKKVKELGAELTSEYQDTFPLAIGVLKGA
FT                   LPFMADLIKHIDTYLEMDFMDVSSYGNSTVSSGEVKIIKDLDTSVEGRDILIIEDIIDS
FT                   GLTLSYLVELFRYRKAKSIKIVTLLDKPSGRKADIKADFVGFEVPDAFVVGYGLDYAER
FT                   YRNLPYIGVLKPAVYES"
     MMKHDIEKVL ISEEEIQKKV KELGAELTSE YQDTFPLAIG VLKGALPFMA DLIKHIDTYL        60
     EMDFMDVSSY GNSTVSSGEV KIIKDLDTSV EGRDILIIED IIDSGLTLSY LVELFRYRKA       120
     KSIKIVTLLD KPSGRKADIK ADFVGFEVPD AFVVGYGLDY AERYRNLPYI GVLKPAVYES       180
//

If you have problems or comments...

PBIL Back to PBIL home page