(data stored in SCRATCH zone)

EMBL: AL009126.HXLA

AL009126.HXLA        Location/Qualifiers
FT   CDS             complement(375166..375798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hxlA"
FT                   /locus_tag="BSU_03460"
FT                   /old_locus_tag="BSU03460"
FT                   /product="3-hexulose-6-phosphate synthase (HPS)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.8: Protect"
FT                   /EC_number="4.1.2.43"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10572115, 15978081; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03460"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12140"
FT                   /db_xref="GOA:P42405"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017553"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="SubtiList:BG11183"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42405"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10572115, 15978081"
FT                   /protein_id="CAB12140.1"
FT                   /translation="MELQLALDLVNIPEAIELVKEVEQYIDVVEIGTPVVINEGLRAVK
FT                   EIKEAFPQLKVLADLKIMDAGGYEIMKASEAGADIITVLGATDDATIKGAVEEAKKQKK
FT                   KILVDMINVKDIESRAKEIDALGVDYICVHTGYDLQAEGKNSFEELTTIKNTVKNAKTA
FT                   IAGGIKLDTLPEVIQQKPDLVIVGGGITSAADKAETASKMKQLIVQG"
     MELQLALDLV NIPEAIELVK EVEQYIDVVE IGTPVVINEG LRAVKEIKEA FPQLKVLADL        60
     KIMDAGGYEI MKASEAGADI ITVLGATDDA TIKGAVEEAK KQKKKILVDM INVKDIESRA       120
     KEIDALGVDY ICVHTGYDLQ AEGKNSFEEL TTIKNTVKNA KTAIAGGIKL DTLPEVIQQK       180
     PDLVIVGGGI TSAADKAETA SKMKQLIVQG                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page