(data stored in ACNUC7421 zone)

EMBL: AL009126.HXLB

AL009126.HXLB        Location/Qualifiers
FT   CDS             complement(374603..375160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hxlB"
FT                   /locus_tag="BSU_03450"
FT                   /old_locus_tag="BSU03450"
FT                   /product="6-phospho-3-hexuloisomerase (PHI)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.8: Protect"
FT                   /EC_number="5.3.1.27"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10572115, 15978081; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03450"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12139"
FT                   /db_xref="GOA:P42404"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR017552"
FT                   /db_xref="PDB:1M3S"
FT                   /db_xref="PDB:1VIV"
FT                   /db_xref="SubtiList:BG11182"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42404"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10572115, 15978081"
FT                   /protein_id="CAB12139.1"
FT                   /translation="MKTTEYVAEILNELHNSAAYISNEEADQLADHILSSHQIFTAGAG
FT                   RSGLMAKSFAMRLMHMGFNAHIVGEILTPPLAEGDLVIIGSGSGETKSLIHTAAKAKSL
FT                   HGIVAALTINPESSIGKQADLIIRMPGSPKDQSNGSYKTIQPMGSLFEQTLLLFYDAVI
FT                   LKLMEKKGLDSETMFTHHANLE"
     MKTTEYVAEI LNELHNSAAY ISNEEADQLA DHILSSHQIF TAGAGRSGLM AKSFAMRLMH        60
     MGFNAHIVGE ILTPPLAEGD LVIIGSGSGE TKSLIHTAAK AKSLHGIVAA LTINPESSIG       120
     KQADLIIRMP GSPKDQSNGS YKTIQPMGSL FEQTLLLFYD AVILKLMEKK GLDSETMFTH       180
     HANLE                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page