(data stored in SCRATCH zone)

EMBL: AL009126.ILVE

AL009126.ILVE        Location/Qualifiers
FT   CDS             259016..260086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="BSU_02390"
FT                   /old_locus_tag="BSU02390"
FT                   /product="isoleucine-valine aminotransferase / aromatic
FT                   amino acid aminotransferase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.6.1.42"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12670965, 15060025, 15102328,
FT                   20332210, 23429746; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02390"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12033"
FT                   /db_xref="GOA:O31461"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="SubtiList:BG12749"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31461"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12670965, 15060025, 15102328, 20332210, 23429746"
FT                   /protein_id="CAB12033.1"
FT                   /translation="MNKLIEREKTVYYKEKPDPSSLGFGQYFTDYMFVMDYEEGIGWHH
FT                   PRIAPYAPLTLDPSSSVFHYGQAVFEGLKAYRTDDGRVLLFRPDQNIKRLNRSCERMSM
FT                   PPLDEELVLEALTQLVELEKDWVPKEKGTSLYIRPFVIATEPSLGVKASRSYTFMIVLS
FT                   PVGSYYGDDQLKPVRIYVEDEYVRAVNGGVGFAKTAGNYAASLQAQRKANELGYDQVLW
FT                   LDAIEKKYVEEVGSMNIFFVINGEAVTPALSGSILSGVTRASAIELIRSWGIPVREERI
FT                   SIDEVYAASARGELTEVFGTGTAAVVTPVGELNIHGKTVIVGDGQIGDLSKKLYETITD
FT                   IQLGKVKGPFNWTVEV"
     MNKLIEREKT VYYKEKPDPS SLGFGQYFTD YMFVMDYEEG IGWHHPRIAP YAPLTLDPSS        60
     SVFHYGQAVF EGLKAYRTDD GRVLLFRPDQ NIKRLNRSCE RMSMPPLDEE LVLEALTQLV       120
     ELEKDWVPKE KGTSLYIRPF VIATEPSLGV KASRSYTFMI VLSPVGSYYG DDQLKPVRIY       180
     VEDEYVRAVN GGVGFAKTAG NYAASLQAQR KANELGYDQV LWLDAIEKKY VEEVGSMNIF       240
     FVINGEAVTP ALSGSILSGV TRASAIELIR SWGIPVREER ISIDEVYAAS ARGELTEVFG       300
     TGTAAVVTPV GELNIHGKTV IVGDGQIGDL SKKLYETITD IQLGKVKGPF NWTVEV           356
//

If you have problems or comments...

PBIL Back to PBIL home page