(data stored in ACNUC7421 zone)

EMBL: AL009126.ISPD

AL009126.ISPD        Location/Qualifiers
FT   CDS             109789..110487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="BSU_00900"
FT                   /old_locus_tag="BSU00900"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase, nonmevalonate isoprenoid pathway"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.7.60"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 15044829, 15379557,
FT                   16533036, 17081012, 17458547, 23840410, 27821871; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00900"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11866"
FT                   /db_xref="GOA:Q06755"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="PDB:5DDT"
FT                   /db_xref="PDB:5DDV"
FT                   /db_xref="PDB:5HS2"
FT                   /db_xref="SubtiList:BG10152"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06755"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 15044829, 15379557, 16533036, 17081012,
FT                   17458547, 23840410, 27821871"
FT                   /protein_id="CAB11866.1"
FT                   /translation="MSYDVVIPAAGQGKRMKAGRNKLFIELKGDPVIIHTLRVFDSHRQ
FT                   CDKIILVINEQEREHFQQLLSDYPFQTSIELVAGGDERQHSVYKGLKAVKQEKIVLVHD
FT                   GARPFIKHEQIDELIAEAEQTGAAILAVPVKDTIKRVQDLQVSETIERSSLWAVQTPQA
FT                   FRLSLLMKAHAEAERKGFLGTDDASLVEQMEGGSVRVVEGSYTNIKLTTPDDLTSAEAI
FT                   MESESGNKHV"
     MSYDVVIPAA GQGKRMKAGR NKLFIELKGD PVIIHTLRVF DSHRQCDKII LVINEQEREH        60
     FQQLLSDYPF QTSIELVAGG DERQHSVYKG LKAVKQEKIV LVHDGARPFI KHEQIDELIA       120
     EAEQTGAAIL AVPVKDTIKR VQDLQVSETI ERSSLWAVQT PQAFRLSLLM KAHAEAERKG       180
     FLGTDDASLV EQMEGGSVRV VEGSYTNIKL TTPDDLTSAE AIMESESGNK HV               232
//

If you have problems or comments...

PBIL Back to PBIL home page