(data stored in SCRATCH zone)

EMBL: AL009126.ISPE

AL009126.ISPE        Location/Qualifiers
FT   CDS             53516..54385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="BSU_00460"
FT                   /old_locus_tag="BSU00460"
FT                   /product="4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.1.148"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 11361082, 12682299, 12771135,
FT                   17458547, 23840410; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00460"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11822"
FT                   /db_xref="GOA:P37550"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="SubtiList:BG10109"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37550"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11822.1"
FT                   /translation="MRILEKAPAKINLSLDVTRKRPDGYHEVEMIMTTIDLADRIELTE
FT                   LAEDEVRVSSHNRFVPDDQRNLAYQAAKLIKDRYNVKKGVSIMITKVIPVAAGLAGGSS
FT                   DAAATLRGLNRLWNLNLSAETLAELGAEIGSDVSFCVYGGTALATGRGEKIKHISTPPH
FT                   CWVILAKPTIGVSTAEVYRALKLDGIEHPDVQGMIEAIEEKSFQKMCSRLGNVLESVTL
FT                   DMHPEVAMIKNQMKRFGADAVLMSGSGPTVFGLVQYESKVQRIYNGLRGFCDQVYAVRM
FT                   IGEQNALD"
     MRILEKAPAK INLSLDVTRK RPDGYHEVEM IMTTIDLADR IELTELAEDE VRVSSHNRFV        60
     PDDQRNLAYQ AAKLIKDRYN VKKGVSIMIT KVIPVAAGLA GGSSDAAATL RGLNRLWNLN       120
     LSAETLAELG AEIGSDVSFC VYGGTALATG RGEKIKHIST PPHCWVILAK PTIGVSTAEV       180
     YRALKLDGIE HPDVQGMIEA IEEKSFQKMC SRLGNVLESV TLDMHPEVAM IKNQMKRFGA       240
     DAVLMSGSGP TVFGLVQYES KVQRIYNGLR GFCDQVYAVR MIGEQNALD                   289
//

If you have problems or comments...

PBIL Back to PBIL home page