(data stored in ACNUC7421 zone)

EMBL: AL009126.ISPF

AL009126.ISPF        Location/Qualifiers
FT   CDS             110480..110956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="BSU_00910"
FT                   /old_locus_tag="BSU00910"
FT                   /product="2-C-methyl-D-erythritol-2,4-cyclodiphosphate
FT                   synthase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="4.6.1.12"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9622350, 11997478, 12270818,
FT                   12682299, 17458547, 23840410; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00910"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11867"
FT                   /db_xref="GOA:Q06756"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="PDB:5IWX"
FT                   /db_xref="PDB:5IWY"
FT                   /db_xref="SubtiList:BG10153"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06756"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9622350, 11997478, 12270818, 12682299, 17458547,
FT                   23840410"
FT                   /protein_id="CAB11867.1"
FT                   /translation="MFRIGQGFDVHQLVEGRPLIIGGIEIPYEKGLLGHSDADVLLHTV
FT                   ADACLGAVGEGDIGKHFPDTDPEFKDADSFKLLQHVWGIVKQKGYVLGNIDCTIIAQKP
FT                   KMLPYIEDMRKRIAEGLEADVSQVNVKATTTEKLGFTGRAEGIAAQATVLIQKG"
     MFRIGQGFDV HQLVEGRPLI IGGIEIPYEK GLLGHSDADV LLHTVADACL GAVGEGDIGK        60
     HFPDTDPEFK DADSFKLLQH VWGIVKQKGY VLGNIDCTII AQKPKMLPYI EDMRKRIAEG       120
     LEADVSQVNV KATTTEKLGF TGRAEGIAAQ ATVLIQKG                               158
//

If you have problems or comments...

PBIL Back to PBIL home page