(data stored in SCRATCH zone)

EMBL: AL009126.KBAA

AL009126.KBAA        Location/Qualifiers
FT   CDS             159182..159778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbaA"
FT                   /locus_tag="BSU_01560"
FT                   /old_locus_tag="BSU01560"
FT                   /product="inner membrane protein involved in activation of
FT                   the KinB signaling pathway to sporulation"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8576055, 15849754, 16850406;
FT                   Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01560"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11932"
FT                   /db_xref="GOA:P16449"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="SubtiList:BG10643"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16449"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8576055, 15849754, 16850406"
FT                   /protein_id="CAB11932.1"
FT                   /translation="MKSRGLVRFFFSILAVGALITSIVGFALKWGEYRGLFLTFEAGQI
FT                   FSVLFWFIGVGMIFSVISQMGFFVFLTVHRFALEILRSSSLWNLLQLFFILFVAFDLMY
FT                   VRFLFFGESGESLAGYAWLPVFLLIFGVITAYIKQKQSSKKTFVSSLFLMVVITALEWF
FT                   PALRVNDEDWLYLMLFPLMACNAFQLLMLPKFAAK"
     MKSRGLVRFF FSILAVGALI TSIVGFALKW GEYRGLFLTF EAGQIFSVLF WFIGVGMIFS        60
     VISQMGFFVF LTVHRFALEI LRSSSLWNLL QLFFILFVAF DLMYVRFLFF GESGESLAGY       120
     AWLPVFLLIF GVITAYIKQK QSSKKTFVSS LFLMVVITAL EWFPALRVND EDWLYLMLFP       180
     LMACNAFQLL MLPKFAAK                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page