(data stored in SCRATCH zone)

EMBL: AL009126.KDGD

AL009126.KDGD        Location/Qualifiers
FT   CDS             267890..268816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgD"
FT                   /locus_tag="BSU_02460"
FT                   /old_locus_tag="BSU02460"
FT                   /product="5-dehydro-4-deoxyglucarate dehydratase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="4.2.1.41"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12044674; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02460"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12040"
FT                   /db_xref="GOA:P42235"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017655"
FT                   /db_xref="SubtiList:BG11158"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42235"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12040.2"
FT                   /translation="MSRIRKAPAGILGFPVAPFNTQGKLEEEALFQNIEFLLNEGLEAI
FT                   FIACGSGEFQSLSQKEYEQMVEVAVSAAGGKVPVYTGVGGNLSTALDWAQLSEKKGADG
FT                   YLILPPYLVHGEQEGLYQYAKTIIESTDLNAILYQRDNAVLSVEQIKRLTECEQLVGVK
FT                   DGVGNMDLNINLVYTIGDRLGWLNGMPMAEVTMPAYLPIGFHSYSSAISNYIPHISRMF
FT                   YDALKNGNDELVKELYRHVILPINDIRKQRKGYAVSLIKAGMEIMGLNVRNTARPPVGP
FT                   VEKDHYQQLEAILKQAADRFPKKAATV"
     MSRIRKAPAG ILGFPVAPFN TQGKLEEEAL FQNIEFLLNE GLEAIFIACG SGEFQSLSQK        60
     EYEQMVEVAV SAAGGKVPVY TGVGGNLSTA LDWAQLSEKK GADGYLILPP YLVHGEQEGL       120
     YQYAKTIIES TDLNAILYQR DNAVLSVEQI KRLTECEQLV GVKDGVGNMD LNINLVYTIG       180
     DRLGWLNGMP MAEVTMPAYL PIGFHSYSSA ISNYIPHISR MFYDALKNGN DELVKELYRH       240
     VILPINDIRK QRKGYAVSLI KAGMEIMGLN VRNTARPPVG PVEKDHYQQL EAILKQAADR       300
     FPKKAATV                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page