(data stored in SCRATCH zone)

EMBL: AL009126.LCTE

AL009126.LCTE        Location/Qualifiers
FT   CDS             329774..330739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctE"
FT                   /locus_tag="BSU_03050"
FT                   /old_locus_tag="BSU03050"
FT                   /product="L-lactate dehydrogenase"
FT                   /function="16.10: Respire"
FT                   /EC_number="1.1.1.27"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10809684, 16207915, 19383131;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03050"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12099"
FT                   /db_xref="GOA:P13714"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3PQD"
FT                   /db_xref="PDB:3PQE"
FT                   /db_xref="PDB:3PQF"
FT                   /db_xref="SubtiList:BG19003"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13714"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10809684, 16207915, 19383131"
FT                   /protein_id="CAB12099.2"
FT                   /translation="MMNKHVNKVALIGAGFVGSSYAFALINQGITDELVVIDVNKEKAM
FT                   GDVMDLNHGKAFAPQPVKTSYGTYEDCKDADIVCICAGANQKPGETRLELVEKNLKIFK
FT                   GIVSEVMASGFDGIFLVATNPVDILTYATWKFSGLPKERVIGSGTTLDSARFRFMLSEY
FT                   FGAAPQNVHAHIIGEHGDTELPVWSHANVGGVPVSELVEKNDAYKQEELDQIVDDVKNA
FT                   AYHIIEKKGATYYGVAMSLARITKAILHNENSILTVSTYLDGQYGADDVYIGVPAVVNR
FT                   GGIAGITELNLNEKEKEQFLHSAGVLKNILKPHFAEQKVN"
     MMNKHVNKVA LIGAGFVGSS YAFALINQGI TDELVVIDVN KEKAMGDVMD LNHGKAFAPQ        60
     PVKTSYGTYE DCKDADIVCI CAGANQKPGE TRLELVEKNL KIFKGIVSEV MASGFDGIFL       120
     VATNPVDILT YATWKFSGLP KERVIGSGTT LDSARFRFML SEYFGAAPQN VHAHIIGEHG       180
     DTELPVWSHA NVGGVPVSEL VEKNDAYKQE ELDQIVDDVK NAAYHIIEKK GATYYGVAMS       240
     LARITKAILH NENSILTVST YLDGQYGADD VYIGVPAVVN RGGIAGITEL NLNEKEKEQF       300
     LHSAGVLKNI LKPHFAEQKV N                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page