(data stored in SCRATCH zone)

EMBL: AL009126.LIPC

AL009126.LIPC        Location/Qualifiers
FT   CDS             462431..463072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipC"
FT                   /locus_tag="BSU_04110"
FT                   /old_locus_tag="BSU04110"
FT                   /product="spore coat phospholipase B"
FT                   /function="16.6: Maintain"
FT                   /function="16.3: Control"
FT                   /EC_number="3.1.1.-"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9334321, 17220230, 20057119;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04110"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12218"
FT                   /db_xref="GOA:P42969"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="SubtiList:BG11232"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42969"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9334321, 17220230, 20057119"
FT                   /protein_id="CAB12218.1"
FT                   /translation="MVLRYTALGDSLTTGRGSGLFSPGFVQRFGDMMEADLKTRTAINI
FT                   FARSGLNTEEILGLLSYPYVQKCIRDADMITITGCGNDLIDSVLAYQTSKDETIFSRVS
FT                   AHCHENFEKMIAKVAEIKGENPSPYAIRVFNLYNPFPEIDIAGKWITSFNSHLETLASA
FT                   PHVKIADAYSIFKGKEQEYLSFDGVHPNSKGYQAMAEAVHKLGYKELSVS"
     MVLRYTALGD SLTTGRGSGL FSPGFVQRFG DMMEADLKTR TAINIFARSG LNTEEILGLL        60
     SYPYVQKCIR DADMITITGC GNDLIDSVLA YQTSKDETIF SRVSAHCHEN FEKMIAKVAE       120
     IKGENPSPYA IRVFNLYNPF PEIDIAGKWI TSFNSHLETL ASAPHVKIAD AYSIFKGKEQ       180
     EYLSFDGVHP NSKGYQAMAE AVHKLGYKEL SVS                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page