(data stored in SCRATCH zone)

EMBL: AL009126.LMRB

AL009126.LMRB        Location/Qualifiers
FT   CDS             complement(288653..290092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lmrB"
FT                   /locus_tag="BSU_02670"
FT                   /old_locus_tag="BSU02670"
FT                   /product="flavonoid efflux transporter; drug-export
FT                   protein"
FT                   /function="16.1: Circulate"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15317768, 15849754, 16850406,
FT                   17483215; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02670"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12061"
FT                   /db_xref="GOA:O35018"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="SubtiList:BG12613"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35018"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15317768, 15849754, 16850406, 17483215"
FT                   /protein_id="CAB12061.1"
FT                   /translation="MILETTAKASQQYKVMPIMISLLLAGFIGMFSETALNIALTDLMK
FT                   ELNITAATVQWLTTGYLLVLGILVPVSGLLLQWFTTRQLFTVSLIFSILGTFIAALAPS
FT                   FSFLLAARIVQALGTGLLLPLMFNTILVIFPPHKRGAAMGTIGLVIMFAPAIGPTFSGL
FT                   VLEHLNWHWIFWISLPFLVLALVFGIAYMQNVSETTKPKIDVLSIILSTIGFGGIVFGF
FT                   SNAGEGSGGWSSPTVIVSLIVGVVGLILFSIRQLTMKQPMMNLRAFKYPMFILGVIMVF
FT                   ICMMVILSSMLLLPMYLQGGLVLTAFASGLVLLPGGILNGFMSPVTGRLFDKYGPKWLV
FT                   IPGFVIVTVVLWFFSNVTTTSTAVLIIILHTCLMIGISMIMMPAQTNGLNQLPREFYPD
FT                   GTAIMNTLQQMAGAIGTAVAVSIMAAGQHDYMSTVKNPADPAVIPQALTAGVQHAFVFA
FT                   MIVAIIGLIGAFFMKRVKVDH"
     MILETTAKAS QQYKVMPIMI SLLLAGFIGM FSETALNIAL TDLMKELNIT AATVQWLTTG        60
     YLLVLGILVP VSGLLLQWFT TRQLFTVSLI FSILGTFIAA LAPSFSFLLA ARIVQALGTG       120
     LLLPLMFNTI LVIFPPHKRG AAMGTIGLVI MFAPAIGPTF SGLVLEHLNW HWIFWISLPF       180
     LVLALVFGIA YMQNVSETTK PKIDVLSIIL STIGFGGIVF GFSNAGEGSG GWSSPTVIVS       240
     LIVGVVGLIL FSIRQLTMKQ PMMNLRAFKY PMFILGVIMV FICMMVILSS MLLLPMYLQG       300
     GLVLTAFASG LVLLPGGILN GFMSPVTGRL FDKYGPKWLV IPGFVIVTVV LWFFSNVTTT       360
     STAVLIIILH TCLMIGISMI MMPAQTNGLN QLPREFYPDG TAIMNTLQQM AGAIGTAVAV       420
     SIMAAGQHDY MSTVKNPADP AVIPQALTAG VQHAFVFAMI VAIIGLIGAF FMKRVKVDH        479
//

If you have problems or comments...

PBIL Back to PBIL home page