(data stored in ACNUC7421 zone)

EMBL: AL009126.LYSS

AL009126.LYSS        Location/Qualifiers
FT   CDS             88727..90226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="BSU_00820"
FT                   /old_locus_tag="BSU00820"
FT                   /product="lysyl-tRNA synthetase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="6.1.1.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 14623972, 20649968;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00820"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11858"
FT                   /db_xref="GOA:P37477"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="SubtiList:BG10144"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37477"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 14623972, 20649968"
FT                   /protein_id="CAB11858.1"
FT                   /translation="MSQEEHNHEELNDQLQVRRDKMNQLRDNGIDPFGARFERTHQSQE
FT                   VISAYQDLTKEELEEKAIEVTIAGRMMTKRGKGKAGFAHLQDLEGQIQIYVRKDSVGDD
FT                   QYEIFKSSDLGDLIGVTGKVFKTNVGELSVKATSFELLTKALRPLPDKYHGLKDVEQRY
FT                   RQRYLDLIVNPDSKHTFITRSKIIQAMRRYLDDHGYLEVETPTMHSIPGGASARPFITH
FT                   HNALDIPLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYA
FT                   DYKDIMSLTENLVAHIAQEVLGTTTIQYGEEQIDLKPEWKRIHMVDAVKEATGVDFWEE
FT                   VTVEQAREYAKEHEVEIKDSMTVGHIINEFFEQKIEETLIQPTFIYGHPVEISPLAKKN
FT                   PEDPRFTDRFELFIVGREHANAFTELNDPIDQRERFEAQLKEREAGNDEAHLMDEDFVE
FT                   ALEYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPQMRQR"
     MSQEEHNHEE LNDQLQVRRD KMNQLRDNGI DPFGARFERT HQSQEVISAY QDLTKEELEE        60
     KAIEVTIAGR MMTKRGKGKA GFAHLQDLEG QIQIYVRKDS VGDDQYEIFK SSDLGDLIGV       120
     TGKVFKTNVG ELSVKATSFE LLTKALRPLP DKYHGLKDVE QRYRQRYLDL IVNPDSKHTF       180
     ITRSKIIQAM RRYLDDHGYL EVETPTMHSI PGGASARPFI THHNALDIPL YMRIAIELHL       240
     KRLIVGGLEK VYEIGRVFRN EGVSTRHNPE FTMIELYEAY ADYKDIMSLT ENLVAHIAQE       300
     VLGTTTIQYG EEQIDLKPEW KRIHMVDAVK EATGVDFWEE VTVEQAREYA KEHEVEIKDS       360
     MTVGHIINEF FEQKIEETLI QPTFIYGHPV EISPLAKKNP EDPRFTDRFE LFIVGREHAN       420
     AFTELNDPID QRERFEAQLK EREAGNDEAH LMDEDFVEAL EYGMPPTGGL GIGIDRLVML       480
     LTNAPSIRDV LLFPQMRQR                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page